KEGG   Niabella soli: NIASO_15375Help
Entry
NIASO_15375       CDS       T03682                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
nso  Niabella soli
Pathway
nso00564  Glycerophospholipid metabolism
nso01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nso00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    NIASO_15375
Enzymes [BR:nso01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     NIASO_15375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 Pyr_redox_2 HI0933_like GIDA NAD_binding_8 FAD_binding_3 Pyr_redox_3 Thi4 AAA_lid_10 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AHF16156
UniProt: W0F4B4
LinkDB All DBs
Position
complement(3352936..3354492)
Genome map
AA seq 518 aa AA seqDB search
MKTERISLLKAATAKDVLWDVVVIGGGATGLGTALEAVTRGYKTLLLEQSDFAKGTSSRS
TKLVHGGVRYLAQGNVGLVREASIERGLLLQNAPHLVKNQTFIIPVYSFTDRLKYTIGLK
LYDWIAGRLSLGRSYFISRKKALEALPGINQEKLTGGVLYHDGQFDDSRLAINLAQTIIE
EGGVAINYMKVLGLEKPDAKGHTVVEAEDMEQGVSYKIKTKAVVNATGVFVDAILKMEDP
AAPKSVVASQGIHLVLNKTFFSSAEALMIPKTNDGRVLFAVPWHNEVVVGTTDTPVGVPS
MEPRPLEKEITFILNTVGNYLVKKPCRKDVQSVFVGLRPLAAPKEGAQKTKEISRSHKII
ISPTNLFTIIGGKWTTYRKMGEDMVDAIEKKLNWPLTKTRTPHLKIHGYKEGMNWEDPYY
FYGSDAEGAKTASEEQRISDKLRIDKAQVVWAVQHEMARTVEDFLARRTRALFLDARESI
RICQEVATIMAAALNRDDDWIQNETVQFRELAQQYLLN
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacggagcggatttcgttgctaaaagcagccacagcaaaggatgtgctgtgggat
gtagttgttattggtggtggggctacgggattgggaacagccctggaggcggttacccgg
gggtataaaacattattgctggaacagtcggattttgcaaaaggaacttcaagtcgcagc
accaagttggtacacggcggcgttcgttacctggcacagggcaatgtagggttggtaagg
gaggcgagcattgagcgggggctcttactgcagaacgctccgcacctggtaaaaaatcaa
acctttattatcccggtttattcttttacagaccggctaaaatataccattggattaaaa
ttatatgattggatcgccggccggctgtcgctggggcgctcttattttatctcccgtaaa
aaagcgctggaagcattgccgggaataaatcaggaaaaacttaccggcggtgttttatac
cacgacggacagtttgacgattcgaggcttgcgataaacctggcgcaaacaattattgag
gaagggggtgtggcaataaactatatgaaagtattggggcttgaaaaacccgatgcgaag
gggcacaccgttgtggaagccgaagatatggaacaaggcgtttcgtataaaataaaaaca
aaggcagtggtaaatgccaccggcgtatttgttgacgctattttaaaaatggaagacccg
gcggcccccaaaagcgtggtggcaagtcaggggatacaccttgttttaaacaaaaccttt
ttttcttctgccgaggcgctgatgattcccaaaacgaacgacgggcgggtgctgtttgct
gttccctggcataatgaagtggtggtgggtacaacagacactccggtgggcgttccttct
atggagcccaggccgcttgagaaggaaattaccttcattttaaatacggtgggaaattat
cttgtaaaaaagccttgcaggaaagacgtgcaaagcgtatttgtgggcttacgtcctctg
gcggctccaaaagaaggcgcccagaaaacaaaagaaatatcgcgcagccataaaattatt
atcagccccacgaacctgtttaccattatcgggggtaaatggaccacctatagaaagatg
ggggaagatatggtggatgctattgaaaaaaaattaaactggccgcttaccaaaacaaga
accccgcatttgaaaattcatggatataaagaagggatgaattgggaagacccctactat
ttctatggaagtgatgcggaaggcgcgaagacagcaagcgaggaacaacgcatcagcgac
aagcttaggatcgataaagcacaggtagtatgggctgtgcagcatgaaatggcccgtacg
gtggaggattttctagcacggcgcacccgggcactttttttagatgcaagggaaagtatc
aggatctgccaggaggtagcaacaatcatggctgctgcgttaaacagagatgacgattgg
attcagaatgaaactgtacaattcagggagctggcgcagcaatatttattaaactaa

DBGET integrated database retrieval system