KEGG   Niabella soli: NIASO_16765Help
Entry
NIASO_16765       CDS       T03682                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
nso  Niabella soli
Pathway
nso00473  D-Alanine metabolism
nso01100  Metabolic pathways
nso01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nso00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NIASO_16765
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    NIASO_16765
Enzymes [BR:nso01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     NIASO_16765
Peptidoglycan biosynthesis and degradation proteins [BR:nso01011]
 Precursor biosynthesis
  Racemase
   NIASO_16765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase_C Mur_ligase FAD_binding_5
Motif
Other DBs
NCBI-ProteinID: AHF16364
UniProt: W0F4H5
LinkDB All DBs
Position
3698713..3701190
Genome map
AA seq 825 aa AA seqDB search
MAGQKYSIAQLAVVLRLPAITADGNVDTLLTDSRKLNNPAASLFFALPGPQRDGQAFIPE
LYKKDVRYFVVPEDMDTSGYPDAVFLKVPEPLHALQTIAAFHRHQFSIDTIGITGSNGKT
VVKEWLYQLLQSYRNIVRSPKSYNSQLGVPLSIWQIAAENDLAIFEAGISKPGEMVRLQR
LIDPTIGVLTNIGSAHSEGFVSDEEKLSEKLDLFSHAKVIIANRDNKLIASGIKKTGVPF
FSWGTDESASVQVVEINTGNDATIISLKEKEGAPFEITIPFTDNASVENAITCATVLLYM
KFDREMIVRGMKALQPVNMRMEFKQGINNCTIINDSYSADLTSLDIALQFLGQQAKGRKQ
TVILSDFFENGINDQQLYPAIYALLKRYGVQRLIGIGEKMQTVLAVLIRQTDAIDATFYL
TTKEFLQHYHSTQYRDEYILVKGARRFGFERIVTLLEQKVHETVLEINLDAVAHNLKAFQ
QQLRPGVKLMAMVKAFAYGSGAAEIASVVQFHKADYLGVAYADEGVELRKAGITIPIMVL
NVEASAFDAITDYNLEPDIFSFELLNSFEQHIKNAGLKNYPVHIEVETGMNRSGFAMEAI
VVLADRLARNEFIRVQSCFSHLAASEDRVEDTFTLHQFTLLKKAAATLEQIIGYSFIKHI
ANTSAILRFPELQLDMVRLGIGLYGIGSTPAVSLQTVATLKTTISQIKRIQKGETVSYNR
RGIAKEDSVIATIRIGYADGYNRRLGNGTGKVFVNGQLAPVMGTVCMDMTMIDITHIPEV
REGDDAIVFGAAVTVQQLAEWVGTIPYEIMTGISQRVKRVYYGEG
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
gtggctggtcaaaaatattccatagcacaattggccgtagtattaaggctcccggcaata
acagcggatggaaacgtagataccttgctgaccgatagtcgcaaactaaataaccccgct
gcttctttattctttgccttaccgggaccccagcgcgacgggcaggcgtttataccagaa
ttatataaaaaagacgtccggtattttgtagtacctgaagatatggacacatcagggtac
cctgatgctgtttttttgaaagtgccggagcccctgcacgccctgcaaaccatcgccgct
tttcaccggcatcaattttccattgatacgatcggtattaccggcagtaacgggaaaacg
gttgtaaaagaatggctgtaccagttgctgcaatcctacagaaatattgtccgcagtccg
aaaagctataactcgcaactgggcgttccgttaagcatttggcaaatagcggctgaaaat
gatctggcaatttttgaagctggcatcagcaagccgggggaaatggttcgcctgcaacgg
cttattgatcccactatcggagtgttaactaatatcggatcggcgcacagcgaagggttt
gtaagtgatgaggagaagctatcagaaaaactggacctcttcagccatgcaaaagttatt
attgctaaccgggataataaattgattgcatcgggtattaaaaaaaccggcgtacctttt
ttttcctggggtacggatgaaagcgcctccgttcaggttgttgagataaacaccggaaac
gacgctactattatcagcttaaaagaaaaagaaggcgccccttttgaaataacgataccg
tttacagacaatgcgtctgttgaaaatgccattacctgcgccacggtgttattgtacatg
aaatttgacagggagatgattgtccgtggaatgaaagcgctgcagccggtaaacatgcgg
atggagtttaagcaggggatcaataactgcaccatcatcaacgatagttatagtgcagat
cttacttcgctggacattgcgctgcaatttttggggcagcaggcaaaaggcaggaaacaa
acagtgatcctctctgatttttttgagaatggcatcaacgatcagcagttatatcccgct
atttacgcgcttttaaagcggtatggtgtacagcggttgatcggtatcggggaaaaaatg
caaacggtgctggcggtgttgatacggcaaacagacgctattgacgccactttttattta
acaacgaaagagttcctgcagcactaccacagtacacaataccgcgatgaatacatcctg
gtgaaaggcgcccggcgatttggttttgagcggatcgtaaccttgctggaacaaaaagtt
catgaaaccgtgctggagatcaacctggatgcggtggcgcataacctgaaagcctttcag
caacagcttcgccccggagtaaaactgatggcaatggtaaaagcctttgcctatggcagc
ggggccgctgaaatagcaagcgtggtacaatttcataaagccgattatttaggtgtggct
tacgccgatgaaggcgtagaactgcggaaagcgggcattaccatcccgattatggtttta
aatgtggaagcctctgcgtttgatgccataacggattataatctggagccggatattttc
agttttgaactgctcaattcttttgaacagcacataaaaaatgcagggttaaaaaattac
ccggttcatattgaagtggaaacaggaatgaaccgttcgggttttgcaatggaggcgata
gttgtattggctgaccgcctggcgcgcaatgaatttataagagtgcaatcctgtttttct
cacctggcggccagcgaagaccgggtggaagacacttttaccctgcaccagtttaccctg
ttaaaaaaagccgctgctacccttgaacaaataatcgggtattcatttataaaacatatt
gccaacacatcggccatccttcgtttccctgaactgcagttggatatggtgcggctgggg
atcggcttgtatggaatcggaagcactccggctgtttcgttacaaacagtagctacgcta
aagacaacgatctcacaaattaaaaggatacaaaaaggcgaaacagtaagctataaccgc
cgggggattgcaaaagaagattctgttatcgccaccatccggatcggctatgccgatgga
tataaccgaagactgggaaacggaacgggaaaagtttttgtcaacgggcaactggcaccg
gtaatgggcaccgtttgtatggacatgaccatgatcgacattacgcatatccctgaggtg
agggaaggcgatgatgcaattgtatttggcgctgccgttacggtgcagcaactggcggaa
tgggttggcaccattccttatgagatcatgacgggcatctcgcaacgcgtaaaacgggtg
tattacggggaaggatga

DBGET integrated database retrieval system