KEGG   Niabella soli: NIASO_17335Help
Entry
NIASO_17335       CDS       T03682                                 

Definition
(GenBank) hypothetical protein
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
nso  Niabella soli
Pathway
nso00511  Other glycan degradation
nso00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:nso00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    NIASO_17335
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    NIASO_17335
Enzymes [BR:nso01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     NIASO_17335
Bacterial toxins [BR:nso02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   NIASO_17335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 BNR_3 BNR Sortilin-Vps10
Motif
Other DBs
NCBI-ProteinID: AHF16456
UniProt: W0F544
LinkDB All DBs
Position
3826006..3827124
Genome map
AA seq 372 aa AA seqDB search
MLTKTFFSIWFCGLVLMVTGCKKQGLVGFEPVNPNAPGLIDSNKYVKLFERGYKGYALFR
IPAIVRAKSGTLLAFAEGRMCGSCGDAGDINMVLKRSTDGGKTWGDLSVIWDDGGNTCGN
PVPIVDETTGTIHLLMSWNNTRAFVTHSTDEGLTWSVPAEITANVKDIGWTWYATGPVHG
IQLTEGTYKGRLIAPTYTTATGLGNKSYSFAVYSDDHGATWKKGALTKQGDVGECTVAET
NAGLLLNMRSAVSNARVLATSIDGGLSWGDNQLQPALVDPKCQGSMISFKQNGSWVLLQS
NAAAQTRTNMTVKMSADDGKSWAKSYTVFYGASAYSDMTLLDDSHIGLLFENGDKNPYDR
IYFKRIPLSNLQ
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcttacgaaaacttttttttcaatatggttttgtggcctggtactgatggtgaccggc
tgtaaaaaacaaggactggtagggtttgaacccgtgaacccgaatgcgccgggcctgata
gactctaataaatatgtaaagctttttgaacggggatataaaggctatgcgctgtttcgc
atccctgcaatcgtgcgggcaaaatccggaacgctgctggcttttgcagaagggcgcatg
tgcggctcctgtggcgatgcgggcgatattaatatggtactgaaaagaagtaccgatgga
ggtaaaacctggggcgacctatcggtgatctgggatgacgggggaaatacctgtggcaat
cctgtgcccattgtggatgaaacaaccggcaccattcaccttctgatgagctggaacaat
acccgcgcatttgtaacacattcaactgatgaaggccttacctggtcggtgcctgcagag
atcaccgctaacgtaaaagacataggctggacctggtatgcaaccggcccggtacatggc
atccagttaacggaaggtacttataagggcagactgatcgctcctacttatacaacggcc
accggtctgggaaataagagttattcttttgctgtttattcagatgatcatggggctacc
tggaaaaagggtgccctcacaaaacagggagatgttggagaatgtacggtggcggaaacc
aatgcaggcctgctgttaaatatgcgttccgcagtatctaatgcgcgcgtattggcaacg
agcatcgacggcgggttaagctggggcgataatcaattacaaccagcactggttgatcca
aagtgccagggaagcatgatcagttttaagcagaatgggagctgggtgttgctgcaatcc
aatgcagccgcgcaaacccgtacaaacatgaccgttaaaatgtctgcggatgatgggaaa
agctgggcaaaatcctataccgttttttatggcgcctccgcttattcggatatgacattg
ctggatgacagccacatcggtctgctcttcgaaaatggcgataaaaacccctacgaccgg
atctattttaaacgcattcctttatccaaccttcaataa

DBGET integrated database retrieval system