KEGG   Nodularia spumigena: BMF81_03775Help
Entry
BMF81_03775       CDS       T05403                                 

Gene name
glgP
Definition
(GenBank) glycogen phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
nsp  Nodularia spumigena
Pathway
nsp00500  Starch and sucrose metabolism
nsp01100  Metabolic pathways
nsp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nsp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BMF81_03775 (glgP)
Enzymes [BR:nsp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     BMF81_03775 (glgP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Capsule_synth
Motif
Other DBs
NCBI-ProteinID: AVZ31256
UniProt: A0A2S0Q4B9
LinkDB All DBs
Position
complement(4273680..4276244)
Genome map
AA seq 854 aa AA seqDB search
MQPIRTFNVSPSLPSRLEPLRQLAYNLHWDWNVESKDLFRRLDTDLWESSRHNPVLMLGT
ISQERLLEVVEDEGFLAQMDRAARQLEEYLHERTWYQKQRSQKPKECYAYFSAEFGLVDC
LPVYSGGLGVLAGDHLKSASDLGLPLVGVGLLYQQGYFAQYLNADGWQQERYPMNDFYNM
PLHLERNPDGSELRIAVDYPGRKVYARVWRVQVGMVPLYMLDTNIEPNNPYDHDITDQLY
GGDIDMRIHQEIMLGIGGVQMLKALGYDVTAYHMNEGHAAFSALERIRILIQEAGLSYKQ
AKQVVASSNIFTTHTPVPAGIDLFAPDKISYYLGYYAEIFGLPKEQFLGLGRENTGDLSA
PFSMAVLALKMATFSNGVAQLHGVVSRQMFQGLWKKVPVEEVPIAAITNGVHARSCVAKS
TQELYDRYLGPNWSSAAPDSPLWDRMDAIPDEELWRNHERCRLDMVVYVREHLVKHLRDR
GASASEIDQAQEVLDPNVLTIGFARRFATYKRATLWMRDLNRIKQILLSNKDRKVQFVIA
GKAHPKDIPGKELIRDINHFIREQHLEKQVVFVPNYDIHIARLMVAGCDVWLNTPRRPRE
ASGTSGMKAAMNGLLNLSVLDGWWDEADYVRTGWSIGHGENYDDPNYQDEVEANALYELL
EKEVVPLFYEHQDVDGLPRSWIAKMKDAIRLNCPFFNTARMVGEYAQRAYFPASDRFTIL
TADNYAPAKELASWKAKLSEQWFNIKIKDIDVSTGADIEVNQTVAVKAKVDLATLTNDDV
RVELYQGTIDANGDITNAVPVVMDYQGQDPENLSIYTGNITYTASGLQGLSLRVLPQHQH
LASPYEPRLIAWAE
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaattcgcacatttaacgtttccccttccttaccatctcgacttgaacccttg
cgacaactagcatataacttgcactgggattggaacgttgagagcaaagatttatttcgt
cgtttagacaccgatttatgggagtctagccgccacaacccggtcttaatgctgggtaca
atcagtcaagagcggctgttggaagttgtggaagatgaaggctttctagcacaaatggat
cgggcggctcgccagttagaagaatacttacacgaacgcacctggtatcagaaacaacgc
agccaaaagccaaaagaatgctacgcctatttttcggctgaattcggacttgtagattgt
ttacctgtctattcaggtggtttgggtgttttagcgggggatcacctcaaatctgctagc
gacttgggtttacctctggttggtgtggggttattgtatcaacaagggtactttgctcaa
tacctgaatgcagatggttggcagcaagaacgctaccccatgaacgatttctataatatg
cccttgcatctagagcgtaatcctgatggttcagaattgcggattgcggtagattaccca
ggacgcaaagtttacgccagagtatggcgcgtacaggtgggaatggtgccactttatatg
ctggataccaacattgaacccaataacccttacgaccacgacatcacagatcaactgtat
ggtggcgacatcgatatgcgaatccaccaggaaattatgctggggatcggtggtgtccag
atgttgaaagcactgggttatgatgtcacggcttaccacatgaatgaaggccatgcggca
ttctcggctttagagcgcatccgcatcttaattcaagaagcaggattgagttataagcaa
gccaaacaggtggtagcttctagcaatatcttcactacccacaccccagtccccgccggg
atagacttgttcgctcccgataaaatttcctattacctgggttactatgcagaaatcttt
ggcttgcctaaagagcaatttttaggactggggcgagaaaatacaggtgatttatctgct
cctttcagtatggcagttttggccttgaagatggcgacattttctaatggtgtggcacag
ttacacggtgtggtatcacgccagatgttccagggtttgtggaaaaaggttccagtggaa
gaagtaccaattgccgcaattaccaatggtgttcatgctcgcagttgtgtggctaaatca
actcaagagttgtacgatcgctacttaggaccaaactggtcatcagcagctccagacagt
ccattatgggatcggatggatgcgatccccgatgaggaattgtggcgcaatcacgaacgc
tgtcgcttagacatggttgtatatgttagagaacatttggttaagcatttgcgcgatcgc
ggtgcttcagcctcggaaattgaccaagcccaagaagttctcgatcccaacgttttaacc
attggctttgctcgacgttttgctacctacaaacgcgctaccctctggatgcgtgatttg
aatagaattaagcagattttgctgagtaacaaagatcgcaaagtgcagtttgtgattgct
ggtaaggctcaccccaaagatatcccagggaaagaactaatccgcgacatcaatcacttt
atccgtgaacaacacttggaaaaacaagtcgtgtttgtgcctaattacgatattcacatt
gctcggttaatggtagctggctgtgatgtctggttaaatacaccacgtcgtccacgggaa
gcttccggtactagcgggatgaaagccgcaatgaatggactgctgaatttaagtgttctt
gatggttggtgggatgaagctgattatgtccgcactggttggtcaattggacatggtgag
aattacgatgatcctaattaccaggatgaggtagaagccaacgctctgtatgagttgtta
gagaaggaagttgtgcctctattctacgagcatcaggatgttgatggtttaccccggtcg
tggattgccaaaatgaaggatgcaattcgcttgaattgtcctttctttaatacagcccgg
atggtaggagaatatgctcaacgggcttattttccagcaagcgatcgctttacaattctg
actgctgataattacgccccagcgaaggaattagctagttggaaagccaaactcagcgaa
cagtggtttaacatcaaaatcaaagatattgatgtatccacaggtgcggatattgaggtg
aaccaaaccgtcgctgtcaaagccaaggttgatttagccactttgactaatgatgatgtc
cgggtggaattataccaaggtacgattgatgccaatggtgacattacgaatgctgtgcct
gtagtcatggattaccaaggacaagatccagaaaacttgagtatttacacgggtaatatt
acctatactgcttctggtttgcagggcttgtctttgcgggttttaccgcagcaccaacac
ttagctagtccctatgagccaagattgattgcttgggcggaatag

DBGET integrated database retrieval system