KEGG   Nocardia seriolae: NS506_00656Help
Entry
NS506_00656       CDS       T04599                                 

Definition
(GenBank) Non-specific serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
nsr  Nocardia seriolae
Brite
KEGG Orthology (KO) [BR:nsr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nsr01001]
    NS506_00656
Enzymes [BR:nsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     NS506_00656
Protein kinases [BR:nsr01001]
 Serine/threonine kinases: Other
  Bacterial family
   NS506_00656
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Pkinase_fungal Kinase-like ABC1 Kdo Seadorna_VP7 RIO1
Motif
Other DBs
NCBI-ProteinID: APA94736
UniProt: A0A1I9YYL6
LinkDB All DBs
Position
complement(659051..660955)
Genome map
AA seq 634 aa AA seqDB search
MTTPKNLSSRYELGEIIGFGGMSEVHKARDLRLGRDVAIKVLRADLARDPTFYLRFKREA
QNAAALNHPAIVAVYDTGEAEIDGGPLPYIVMEYVDGDTLRDIVRGKGPLPPRRAMEVIA
DVCAALDFSHRNGIVHRDMKPANIMINRAGAVKVMDFGIARAIADSSNPMTQTAAVIGTA
QYLSPEQARGEQVDARSDVYSVGCVLYEILTGEPPFTGDSPVAVAYQHVREDPRLPSQVH
PGVPRELDSVVLKAMSKNPANRYQTAAEMRADLIRVLGGQKPTAPMVMTDEDRTGFLDDE
LPPPRSYRTVERRDDTTEQEIVEANPRRRTALIAVLAAVAVAAVAGLLFMLVGPGARPDQ
VAVPDVANQNYQLAQRDLEKAGFVVAIQQKNDPKVAQGNVIATQPLGGSRVDKGSTVTLQ
VSAGPQQVTVPKLAGLTQAQAEQSLNSQGLRLNPEIKKEASSTDDKDKVVAQTPDGGQKI
DSDGQVTITLGSGPDKVRVPDVVGQTVDVAQSTLADTAGFKVTVQEVPNNQPKGTVIATN
PAAGTQADQGSNITVQVSTGDQLTMPDLRGLTPAQAVDMLRQKGWNGQVSQNTMSTLNAG
EVGRILAQQPTAGSALGKSQTVTITTGVLSLGPP
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccccgaagaacctgtcctcgcgctacgagctgggcgagatcatcgggttcggc
ggcatgtccgaggtgcacaaggcccgggatctgcggctcggccgggatgtggcgatcaag
gtgctgcgcgccgatctggcccgcgaccccacgttctacctgcgcttcaagcgggaggcg
cagaacgcggcggcgctgaatcatccggccatcgtggcggtgtacgacaccggcgaggcc
gagatcgacggcggcccgctgccctacatcgtcatggagtacgtggacggcgacaccctg
cgcgacatcgtgcgcggcaagggcccgctgccgccccggcgcgccatggaggtcatcgcc
gatgtgtgtgcggcgctggacttctcgcaccgcaacggcatcgtgcaccgggacatgaag
cccgccaacatcatgatcaaccgcgcgggcgcggtgaaggtgatggacttcggcatcgcc
cgggccatcgccgacagctccaaccccatgacgcagacggccgccgtcatcggcaccgcc
cagtacctctcgcccgagcaggcccgcggcgagcaggtggacgcgcgctcggacgtgtac
tcggtgggctgcgtgctctacgagatcctcaccggcgaaccgcctttcaccggtgattcg
ccggtcgcggtggcctaccagcacgtccgggaggatccgcggctgccctcgcaggtgcat
ccgggcgtaccacgcgaactcgactcggtcgtgctcaaggccatgagcaagaacccggcc
aaccggtaccagaccgccgccgagatgcgcgcggacctgattcgggtgctgggcgggcag
aagccgaccgcgcccatggtcatgaccgacgaggaccgcaccggtttcctcgacgacgaa
ctgccgccgccgcgcagctaccgcaccgtcgaacgccgcgacgacaccaccgaacaggag
atcgtcgaggccaatccgcgccggcgcaccgcgctgatcgccgtgctcgcggcggtcgcg
gtcgcggcggtggccgggctgctgttcatgctggtcggtcccggcgcgcggccggatcag
gtggcggtgccggatgtcgccaaccagaactaccaactcgcgcaacgggatctggagaag
gccggcttcgtggtcgccatccagcagaagaacgatcccaaggtggcgcagggcaatgtg
atcgccacccagccgctgggcggttcgcgagtggacaagggcagcaccgtcaccctccag
gtgtcggcgggcccgcagcaggtgacggtgccgaagctggcgggcctgacccaggcccag
gccgagcagtcactcaattcgcaagggttgcggctgaatccggagatcaagaaggaagcc
tcgagcaccgacgacaaggacaaggtcgtcgcgcagacgcccgacgggggccagaagatc
gattccgacgggcaggtcaccatcaccctgggctccggcccggacaaggtgcgggtgccc
gacgtggtcggccagaccgtcgacgtcgcgcagtccacgctggccgacaccgcgggcttc
aaggtgaccgtccaggaggtgccgaacaaccagcccaagggcacggtcatcgcgaccaat
ccggccgcgggcacccaggccgaccagggctcgaacatcaccgtccaggtctccaccggc
gaccagttgaccatgcccgacctgcgcggcctgaccccggcccaggccgtggacatgctg
cggcagaagggctggaacggtcaggtcagccagaacaccatgagcacgctgaacgcgggc
gaggtcgggcgcatcctggcccagcagccgaccgcgggctcggcgctgggcaagtcgcag
acggtgacgatcaccaccggggtgttgtcgctcggcccgccgtga

DBGET integrated database retrieval system