KEGG   Nocardia seriolae: NS506_00694Help
Entry
NS506_00694       CDS       T04599                                 

Definition
(GenBank) Chaperone protein HtpG
  KO
K04079  molecular chaperone HtpG
Organism
nsr  Nocardia seriolae
Brite
KEGG Orthology (KO) [BR:nsr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nsr01009]
    NS506_00694
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:nsr03110]
    NS506_00694
   04131 Membrane trafficking [BR:nsr04131]
    NS506_00694
   03051 Proteasome [BR:nsr03051]
    NS506_00694
   03029 Mitochondrial biogenesis [BR:nsr03029]
    NS506_00694
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nsr04147]
    NS506_00694
Protein phosphatases and associated proteins [BR:nsr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     NS506_00694
Chaperones and folding catalysts [BR:nsr03110]
 Heat shock proteins
  HSP90
   NS506_00694
Membrane trafficking [BR:nsr04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    NS506_00694
Proteasome [BR:nsr03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    NS506_00694
Mitochondrial biogenesis [BR:nsr03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    NS506_00694
Exosome [BR:nsr04147]
 Exosomal proteins
  Proteins found in most exosomes
   NS506_00694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP90 HATPase_c_3 HATPase_c
Motif
Other DBs
NCBI-ProteinID: APA94773
UniProt: A0A0B8N3K0
LinkDB All DBs
Position
707097..709052
Genome map
AA seq 651 aa AA seqDB search
MTEHVEHLEFQAETHQLLELMIHSVYSNKDTFLRELVSNASDALDKLRLETFRDKDLHAD
TSDLHIELEVDRDERVLTIRDNGIGMSRAEVVDLIGTLAKSGTAALRKQLLEAKPDDQQA
EELIGQFGIGFYSTFMVADKVTLTTRKAGETTGTRWESEAGSPTYSIEELDDAPQGTTVA
LQLKAADEDDHLFDYTQEWKLREIIKKYSDFIAWPIRMDVERTVMDGEGEDKTEKTLVET
QTLNSQKALWTRPRSEVSDEEYIEFYKHVSHAWDDPLEIIPMKAEGTFEYQALLFLPSHA
PFDLFTREHKRGVQLYVRRVFIMDNCEELMPEYLRFVKGVVDAQDLSLNVSREILQQDRQ
IQMIRKRLVRKVLSTVKDLRNAEDKAKYWEFWKEFGRVLKEGLLSDHDNRETILGVSSFA
STHSETEQTSLADYVGRMAESQSSIYYMTGETRQQIENSPHMEAFKAKGLEVLVLTDPVD
EMWVGSVTEFEGKPIVSIAKGEVDLESEDEKKASEQLREQQEKDFAEVLGWLQSTLDAEV
KEVRLTNRLTTSPACIVGDVFDFTPMLERMYRASGQELPHSKRILELNPSHALVTGLRDA
FETVKDEADKPEALTETAELLYGTAVLAEGGELKDPAHFARILADRLTRTL
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaacacgtcgaacacctggagtttcaggccgagacccatcagctgctggagttg
atgatccactcggtgtattcgaacaaggacaccttcctgcgggagctggtctccaatgcc
tccgatgcgctggacaagttgcgcctggagaccttccgcgacaaggacctgcacgcggat
acctccgacctgcacatcgagctggaggtcgaccgcgacgagcgcgtgctgaccatccgc
gacaacggcatcggcatgtcccgggccgaggtggtggatctgatcggcaccctggccaag
tcgggcaccgcggcgctgcgcaagcagctgctcgaggccaagcccgacgatcagcaggcc
gaggagctgatcggccagttcggcatcggcttctactcgaccttcatggtggccgacaag
gtcaccctgaccacccgcaaggcgggcgagaccaccggcacccgttgggaatccgaggcg
ggctcgccgacctactcgatcgaggaactcgacgacgcgccgcagggcaccacggtggcg
ttgcagctcaaggccgccgacgaggacgatcacctcttcgactacacgcaggagtggaag
ctccgcgaaatcatcaagaagtactcggatttcatcgcctggcccatccgtatggatgtc
gagcgcaccgtcatggacggcgagggcgaggacaagaccgagaagaccctggtcgagacc
cagaccctgaactcgcagaaggcgctgtggacgcgcccgcgcagcgaggtctccgacgag
gagtacatcgagttctacaagcacgtctcgcacgcctgggacgatccgctcgagatcatc
cccatgaaggccgagggcaccttcgaataccaggcgctgctgtttcttccgtcgcacgcg
ccgttcgacctgttcacccgcgagcacaagcgcggcgtgcagctctacgtgcgccgggtg
ttcatcatggacaactgcgaagagctgatgccggagtatctgcgcttcgtcaagggcgtg
gtggacgcgcaggacctgtcgctcaatgtgtctcgcgagatcctgcagcaggaccgccag
atccagatgatccgcaagcgcctggtccgcaaggtgctgtccacggtcaaggatctgcgc
aatgccgaggacaaggccaagtactgggagttctggaaggagttcggccgggtcctcaag
gagggcctgctgtcggaccacgacaaccgcgagaccattctgggcgtctcgtccttcgcg
tccacgcattcggagaccgagcagacctcgctggccgactacgtcgggcggatggcggag
tctcagtcgtcgatctactacatgaccggcgagacccgccagcagatcgagaactccccg
cacatggaggcgttcaaggccaagggcctcgaggtgctggtgctgaccgatccggtcgac
gagatgtgggtcggctcggtcaccgagttcgagggcaagccgatcgtgtccatcgccaag
ggcgaggtggacctggagtctgaggacgagaagaaggcctccgagcagctgcgcgagcag
caggagaaggacttcgccgaggtgctcggctggttgcagtcgaccctggacgccgaggtg
aaggaggtacgcctgaccaaccggctcaccacctctccggcctgcatcgtgggtgatgtg
ttcgatttcaccccgatgctcgagcgcatgtaccgcgcctccggtcaggagctgccgcac
agcaagcgcatcctcgaattgaacccgtcgcacgcgctggtcaccggtctgcgtgacgcg
ttcgagacggtgaaggacgaggccgacaagcccgaggcgctcaccgagaccgccgaattg
ctctacggcacggcggttctcgccgagggtggcgagctgaaggatccggcgcacttcgcc
cgcatcctcgccgaccgcctcacccgcaccctctga

DBGET integrated database retrieval system