KEGG   Nocardia seriolae: NS506_00948Help
Entry
NS506_00948       CDS       T04599                                 

Gene name
murE
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
  KO
K23393  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
nsr  Nocardia seriolae
Pathway
nsr00550  Peptidoglycan biosynthesis
nsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NS506_00948 (murE)
Enzymes [BR:nsr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     NS506_00948 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1727 Mur_ligase_M PKD
Motif
Other DBs
NCBI-ProteinID: APA95022
UniProt: A0A0B8NFY4
LinkDB All DBs
Position
982936..984162
Genome map
AA seq 408 aa AA seqDB search
MRGQLALRAATAASWASRRAGRGSGSMIGGLIALKIDPSIMGQLGRGKRTVLVTGTNGKS
TTTRMTTAALQTLGRVATQADGANMDAGIVAALTAHRTAPLAAIEVDELHLPHVADALNP
SVVVLLNLSRDQLDRVGEINMIERRLREGMARHPAAVLVANCDDVLVTSIAYDHPNVVWV
SAGSGWSVDATSCPRSGEPIVWEGEHWYSTGADFKRPEPQWRVDEHALYGPDGLEIPLSL
ALPGRANRGNAAQAVAAAVALGADPAKAAAATGTVREIAGRYRSVDVDGRSTRMLLAKNP
AGWQEALSMIDPAATGLVIAVNGQVPDGEDLSWLWDVCFELFEGTQVVAAGERATDLAVR
LTYAGVEHITVADPLRAIASCPPGRVEVLANYTAFRDLNRDLEAGTKA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggacagttggcgctgcgggcggcgacggcggcgtcgtgggcctcgcggcgggcc
gggcgcggcagcggctccatgatcggcgggctgatcgcgctgaagatcgacccctcgatc
atgggtcagctgggtcgcggcaagcgcactgtgctggtcaccggcaccaacggcaagtcc
accaccacccgcatgaccaccgcggcgctacagaccctgggccgggtggccacccaggcc
gacggcgcgaacatggacgccgggatcgtggccgcgctcaccgcgcaccgtaccgcgccg
ctggcggccatcgaggtggacgaactgcacctgccgcacgtggccgacgccctgaacccc
tcggtcgtggtgttgctgaacctttcccgcgaccagctggaccgggtcggcgagatcaat
atgatcgagcgccgcctgcgcgagggcatggcccgccatcccgcggccgtgctcgtcgcc
aactgcgatgacgtgctggtcacctccatcgcctacgaccacccgaatgtggtgtgggta
tcggccggcagcggctggtcggtggacgccaccagctgcccgcgcagcggcgagcccatt
gtgtgggagggcgagcactggtacagcaccggcgcggatttcaagcgccccgagccgcag
tggcgggtcgacgagcacgcgctgtacgggccggacgggctggaaatcccgctctccctt
gcccttccgggccgtgccaatcgcggcaatgcggcccaagccgtggccgccgcggtagcg
ctgggcgcggatccggcgaaggccgccgcggccaccggcaccgtccgcgagatcgcgggc
cgctaccgcagtgtcgacgtggacggccgcagcacccgcatgctgctggccaagaacccg
gcgggctggcaggaggcgctgtccatgatcgacccggccgcaacgggtctggtgatcgcg
gtcaacggccaggtgcccgacggcgaggacctgtcctggctgtgggacgtgtgcttcgag
ctcttcgagggcacccaggtggtggccgccggcgagcgcgccaccgacctcgcggtgcgc
ctgacctacgctggagtcgagcacatcaccgtcgcggatcccttgcgcgccatcgcctcc
tgccctcccggccgcgtcgaagtgctggccaactacaccgcgttccgcgacctgaaccgc
gatctggaggcggggaccaaggcatga

DBGET integrated database retrieval system