KEGG   Nocardia seriolae: NS506_02926Help
Entry
NS506_02926       CDS       T04599                                 

Definition
(GenBank) Succinate-semialdehyde dehydrogenase (NAD(P)(+))
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
nsr  Nocardia seriolae
Pathway
nsr00250  Alanine, aspartate and glutamate metabolism
nsr00310  Lysine degradation
nsr00350  Tyrosine metabolism
nsr00650  Butanoate metabolism
nsr00760  Nicotinate and nicotinamide metabolism
nsr01100  Metabolic pathways
nsr01120  Microbial metabolism in diverse environments
Module
nsr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nsr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NS506_02926
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NS506_02926
   00310 Lysine degradation
    NS506_02926
   00350 Tyrosine metabolism
    NS506_02926
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NS506_02926
Enzymes [BR:nsr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     NS506_02926
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     NS506_02926
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     NS506_02926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: APA96985
UniProt: A0A0B8ND90
LinkDB All DBs
Position
complement(3135221..3136675)
Genome map
AA seq 484 aa AA seqDB search
MRDVAELLAAVPTGLWIGGAQVPASDGGTFPVHDPATGEVLVEVSDATAADGARALDAAV
AAQASWAATPARERSEILRRAWELVMARRDDFALLMTLEMGKPLAEAQGEVVYGGEFLRW
FGEEAVRINGRYTPSPSGNGRILVTKQPVGPTLAITPWNFPLAMGTRKIAPAFAAGCTMV
VKPAAETPLTMLLLGAVFAEAGLPAGVLSILPTSKAARLTDPMFADDRLRKVTFTGSTPV
GKVLLAQSAARVLRTSMELGGNAPFVVFADADLDAAVGGAMAAKMRNIGEACTAANRFHV
DTAVLAEFTARLTERMRGLKIGPGHLDGIQVGPLISAKQRDSVAELVADAVAKGARVATG
GAAVPGPGWFYEPTVLTEVPADARILREEVFGPVAAITGFDGEAAGIAAANDTEFGLAAY
IYTRDLDRALRVSEALESGMVGVNRGIISDVAAPFGGVKQSGLGREAGTEGIEEYLETKY
IALP
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatgtggccgagctgctggcggccgtgccgaccggactgtggatcggcggtgcg
caggtccccgcgagcgacggcggcaccttccccgtgcacgatccggcgaccggcgaggta
ctggtcgaggtgtccgacgccaccgccgccgacggggcgcgcgcactggacgccgcggtc
gccgcgcaggcgtcctgggcggccaccccggcccgggagcgctccgagatcctgcgccgc
gcttgggagctcgtcatggcgcgccgcgacgacttcgcgctgctgatgaccctggagatg
ggcaagccgctggccgaggcgcagggcgaagtggtctacggcggcgaattcctgcgctgg
ttcggcgaggaggcggtgcggatcaacggccgctacacgccgtcgccgtcgggcaacggg
cgcattctggtgaccaaacagccggtcggcccgacactggccatcaccccgtggaacttc
ccgctggccatgggaacccgaaagatcgcacccgccttcgccgccgggtgcacgatggtg
gtcaaaccggccgccgagacgccgttgaccatgctgctgctgggtgcggtgttcgccgag
gccgggctgcccgcgggcgtgctgtccatcctgccgacctcgaaggcggcgcggctcacc
gatccgatgttcgccgacgaccggctgcgcaaggtgaccttcaccgggtccaccccggtc
ggcaaggtgctgctcgcgcagtcggccgcgcgggtgctgcgcacctccatggaactcggc
ggcaatgcgccgttcgtggtgttcgccgacgccgacctggacgcggcggtgggcggcgcc
atggccgcgaagatgcgcaatatcggcgaggcgtgcacggccgccaatcgattccacgtc
gacactgcggtgctggcggagttcaccgcgcggctgaccgagcgcatgcgcggactgaag
atcgggccgggccacctcgacggaatccaggtcgggccgttgatcagtgcgaagcaacgc
gattcggtggccgagctggtcgccgacgcggtcgccaagggcgcgcgcgtcgcgaccggc
ggcgccgcggtgccgggcccgggctggttctacgaaccgaccgtgctgaccgaggtcccc
gccgacgcccgcatcctgcgcgaggaggtgttcggcccggtcgccgccatcaccggtttc
gacggcgaggccgccggcatcgccgccgccaatgacaccgaattcggtttggccgcctac
atctacacccgcgacctggaccgcgcgctccgcgtctccgaggccctcgaatccggcatg
gtcggggtgaaccgcggcatcatatccgacgtggccgcgcccttcggcggggtgaagcag
tccgggctggggcgcgaggccggcaccgagggcatcgaggaatacctggagaccaaatac
atcgcgctgccctag

DBGET integrated database retrieval system