KEGG   Nocardia seriolae: NS506_06068Help
Entry
NS506_06068       CDS       T04599                                 

Definition
(GenBank) Alkanesulfonate monooxygenase
Organism
nsr  Nocardia seriolae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_luciferase PP-binding
Motif
Other DBs
NCBI-ProteinID: APB00105
UniProt: A0A1I9ZE27
LinkDB All DBs
Position
complement(6372214..6373539)
Genome map
AA seq 441 aa AA seqDB search
MSTSSETATVLHFFVEWAADRLERDAVDPHSPLTSLGLDSVKAAELMTILEDRFDAEITA
EEIFDGLSLADVAETATAARGNGHPPADEPGSGPRREMDFSLLFFSSDAQRHAAGGRYEL
LLDSARFADAHGLRAIWLPERHFHSFGGLYPNPSVLGAALAAATERVRIRAGSVVLPLHN
PIRVAEDWSAVDNLSGGRVDLAFATGWNADDFVLAPDNYADRVELTRTGIDTVRRLWRGE
SVTRPNGVGETREVRIFPAPVQPALATWLTCSGGVERFAMAGALGVNVLTALLFQEVDDL
GEKLAAYRAARAEHGHGADTGHVTVMLHTFLGGDEAAVRRTVEGPFKRYLEDSVDLWRRG
SEALESLDAKTRVKVLDFAFERYYRNNGLFGTPDSTAAMVARLRGIGVDEIACLIDFGIP
DAEVLGGLEALARLRALTAAR
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagtacctcgtccgagaccgcgaccgtgctgcacttcttcgtggagtgggccgccgac
cggctcgagcgcgacgcggtggacccgcactccccgctcacctcgctgggcctggattcg
gtcaaggccgcggaactgatgaccatcctggaggaccggttcgacgccgagatcaccgcc
gaggagatcttcgacggcctgagcctggccgatgtcgccgagacggccaccgccgcacgc
ggaaacggccacccgcccgccgacgagcccgggtccgggccccggcgcgagatggacttc
agcctgctgttcttctccagtgacgcacaacggcatgcggccggcggccgctacgaactg
ctgctcgacagcgcccgcttcgccgacgcgcacggactgcgcgcgatctggctgccggaa
cggcacttccacagcttcggcggcctgtacccgaacccgtcggtgctgggcgcggcgctg
gccgccgccaccgagcgggtgcgcatccgggcgggcagtgtggtgctgccgctgcacaat
ccgatccgcgtcgccgaggactggtcggcggtggacaacctctcgggcgggcgcgtggac
ctggccttcgccaccgggtggaacgccgacgatttcgtgctcgccccggacaactacgcc
gaccgggtcgagctgacccgcaccggcatcgacaccgtgcgacggctgtggcgcggcgaa
tcggtcacccggcccaatggtgtgggcgagacccgcgaggtgcggatcttcccggccccc
gtacagcccgcgctggcgacctggctcacctgcagcggcggtgtcgagcgcttcgccatg
gccggtgcgctcggggtgaatgtgctgaccgcgctgctgttccaggaggtggacgacctg
ggggagaagctggccgcctaccgggcggcgcgggccgagcacggccacggggccgatacc
ggccacgtcaccgtcatgctgcacaccttcctgggcggcgacgaggcggcggtccgccgg
accgtcgagggcccgttcaagcgctacctggaggattcggtcgatctgtggcggcgcggg
tcggaggcgctcgagagcctcgacgccaagacccgggtcaaggtgctggacttcgccttc
gaacgctactaccgcaacaacggcctgttcggcaccccggattccacggccgccatggtc
gcccggctgcgcgggatcggcgtcgacgagatcgcctgcctgatcgacttcggcatcccc
gacgccgaggtgctgggcgggctcgaggcgctggcgcgactgcgggccctgacagcggcg
cggtga

DBGET integrated database retrieval system