KEGG   Nocardia seriolae: NS506_06548Help
Entry
NS506_06548       CDS       T04599                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
nsr  Nocardia seriolae
Pathway
nsr00473  D-Alanine metabolism
nsr00550  Peptidoglycan biosynthesis
nsr01100  Metabolic pathways
nsr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nsr00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    NS506_06548
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NS506_06548
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    NS506_06548
Enzymes [BR:nsr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NS506_06548
Peptidoglycan biosynthesis and degradation proteins [BR:nsr01011]
 Precursor biosynthesis
  Amino acid ligase
   NS506_06548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 CPSase_L_D2 RimK ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: APB00581
UniProt: A0A1I9ZEZ8
LinkDB All DBs
Position
complement(6863746..6864825)
Genome map
AA seq 359 aa AA seqDB search
MAVVFGGRSNEHGVSCVSARTVLASLDPERYEAVPIGITRDGTWVLGDADPRALTAAGRA
LPAVDESGTALALTADPTRAGALVPLDGADAVLGTVDVVFPVLHGAFGEDGTLQGLLELA
ELPYVGPGVLASAAGMDKEFTKKLLAAEGLPIGVQVVLRPGVATVAEADRARLGLPVFVK
PARGGSSIGITKVDEWDDLDAAIAVARQHDPKVIVEAGIVGREVECGVLEFPDGRVEASV
VAEIRMPEDEAEAPDFYDFDTKYLDDVCEFDVPAKLDDDVSQQIRELAVRAFRALDCQGL
ARVDFFVTADGPVINEINTMPGFTSISMYPRMWEATGIDNRTLVSTLIETARTRGTGLR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
gtggcggtggtgttcggcggccgcagcaacgagcacggggtgtcgtgcgtttccgcgcgc
accgtgctggcgagcctcgatcccgagcggtacgaagcggttccgatcgggatcacccgg
gacggcacctgggtgctcggcgacgcggatccgcgcgcgctgaccgccgcgggccgcgcg
ctacccgcggtcgacgaatccggcaccgcgctggccctgaccgccgaccccacccgcgcg
ggcgcgctggtgcccctcgacggcgcggacgcggtgctgggcaccgtggacgtggtgttc
ccggtgctgcacggcgcgttcggcgaggacggcaccctgcaggggctgctggagctggcc
gagctgccctacgtcggtcccggcgtgctggccagcgcggccggtatggacaaggagttc
accaagaaactccttgcggccgaaggacttccgatcggggtgcaggtggtgctgcggccc
ggcgtggcgacggtggccgaggccgaccgggcgcggctggggctgccggtgttcgtgaag
cccgcgcgcggcgggtcgtccatcggcatcaccaaggtggacgagtgggatgatctcgac
gccgccatcgccgttgcgcgacagcatgatccgaaggtgatcgtggaggcgggcatcgtc
gggcgcgaagtcgagtgcggcgtactggaattcccggacggtcgggtggaagccagtgtg
gtggcggagatccggatgcccgaggacgaggccgaagcgcccgacttctacgacttcgac
accaagtacctcgacgacgtctgcgagttcgacgtccccgccaagctggatgacgatgtc
tcccagcagatccgggagctggcggtgcgcgccttccgggcgctggactgccagggcctg
gcgcgcgtcgacttcttcgtgaccgccgacggcccggtcatcaacgagatcaacaccatg
cccggattcacctcgatctccatgtacccgcgcatgtgggaggccaccggcatcgacaat
cggacgctggtgagcaccctcatcgagaccgcccgcacccgcggcaccggcctgcgctga

DBGET integrated database retrieval system