KEGG   Nocardia seriolae: NS506_07396Help
Entry
NS506_07396       CDS       T04599                                 

Gene name
idh1
Definition
(GenBank) Isocitrate dehydrogenase (NADP(+))
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
nsr  Nocardia seriolae
Pathway
nsr00020  Citrate cycle (TCA cycle)
nsr00480  Glutathione metabolism
nsr01100  Metabolic pathways
nsr01110  Biosynthesis of secondary metabolites
nsr01120  Microbial metabolism in diverse environments
nsr01130  Biosynthesis of antibiotics
nsr01200  Carbon metabolism
nsr01210  2-Oxocarboxylic acid metabolism
nsr01230  Biosynthesis of amino acids
Module
nsr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nsr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:nsr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NS506_07396 (idh1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NS506_07396 (idh1)
Enzymes [BR:nsr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     NS506_07396 (idh1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: APB01416
UniProt: A0A0B8NDN8
LinkDB All DBs
Position
complement(7728572..7729789)
Genome map
AA seq 405 aa AA seqDB search
MSKIKVEGTVVELDGDEMTRIIWQFIKDKLIVPYLDVNLEYYDLGIEARDKTDDQITIDA
ANAIKKHGVGVKCATITPDEARVEEFGLKKMWRSPNGTIRNILGGTIFRAPIIISNVPRL
VPGWTKPIIIGRHAFGDQYRATDFKVHQAGTVTLTFTPEDGSEPIVQEVVKMPEDGGVVM
GMYNFQDSIRDFARASLNYGLQQNYPVYMSTKNTILKAYDGMFKDTFEEVYQTEFKDEFD
AAGLTYEHRLIDDMVASALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLLTPDG
RTCEAEAAHGTVTRHYRQHQQGKPTSTNPIASIFAWTRGLAHRGKLDNTPEVIGFAQTLE
DVVIKTVESGQMTKDLALLVGGDQGYLTTEEFLGVLDANLAREIR
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagatcaaggttgaagggaccgtcgtcgagctcgatggcgacgagatgacccgg
atcatctggcagttcatcaaggacaagctcatcgtcccgtatctcgatgtgaacctcgag
tactacgacctcggcatcgaggcccgggacaagaccgacgatcagatcaccatcgacgcg
gccaacgccatcaagaagcacggcgtcggcgtcaagtgcgcgacgatcacccccgatgag
gcgcgagtcgaggaattcggcctcaagaagatgtggcggtcgcccaacggcaccatccgc
aacattctgggtggcacgatcttccgcgcgccgatcatcatctcgaacgttccgcgtctg
gttccgggctggaccaagccgatcatcatcggccgccacgccttcggtgaccagtaccgc
gccaccgacttcaaggtgcaccaggcgggcaccgtcaccctcaccttcacgcccgaggac
ggctccgagccgatcgtccaggaagtcgtgaagatgccggaagacggcggcgtcgtgatg
ggcatgtacaacttccaggactccatccgggacttcgcgcgggcctcgctgaactacggc
ctgcagcagaactacccggtgtacatgtcgaccaagaacaccatcctcaaggcctacgac
ggcatgttcaaggacaccttcgaggaggtgtaccagaccgagttcaaggacgagttcgac
gccgccggtctgacctacgagcaccgcctcatcgacgacatggtcgcctccgcgctcaag
tgggagggcggctacgtctgggcctgcaagaactacgacggcgacgtgcagtccgacacc
gtggcgcagggcttcggctcgctgggtctgatgacctccgtgctgctcaccccggacggc
cgcacctgcgaggccgaggccgcgcacggcaccgtgacccggcactaccgtcagcaccag
cagggcaagcccacctccaccaacccgatcgcctcgatattcgcgtggacgcgtggcctg
gcccaccgcggcaagctggacaacacccccgaggtgatcggcttcgcgcagaccctcgag
gacgtggtcatcaagacggtcgagtccggccagatgaccaaggacctcgcgctgctggtc
ggcggcgaccagggttacctgaccaccgaggagttcctcggcgtgctggacgccaacctg
gcccgcgagattcgctag

DBGET integrated database retrieval system