KEGG   Nicotiana sylvestris: 104213611Help
Entry
104213611         CDS       T05026                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00250  Alanine, aspartate and glutamate metabolism
nsy00410  beta-Alanine metabolism
nsy00430  Taurine and hypotaurine metabolism
nsy00650  Butanoate metabolism
nsy01100  Metabolic pathways
nsy01110  Biosynthesis of secondary metabolites
Module
nsy_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    104213611
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    104213611
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104213611
   00430 Taurine and hypotaurine metabolism
    104213611
Enzymes [BR:nsy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     104213611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 104213611
NCBI-ProteinID: XP_009761443
UniProt: A0A1U7V4Y1
LinkDB All DBs
Position
Unknown
AA seq 502 aa AA seqDB search
MVVTTTSISDSNENLHCTFASRYVQESLPKFKIPGRSMPKEAAFQIVNDELMLDGNPRLN
LASFVSTWMEPECDKLIMSSINKNYVDMDEYPVTTELQNRCVNMLAHLFHAPVGDDETAI
GVGTVGSSEAIMLAGLAFKRKWQARRKAEGKPFDKPNIVTGANVQVCWEKFARYFEVELK
EVKLKEGYYVMDPAKAVELVDENTICVAAILGSTLTGEFEDVKLLNELLVKKNKETGWDT
PIHVDAASGGFIAPFLWPDLEWDFRLPLVKSINVSGHKYGLVYAGVGWVIWRSKEDLPEE
LVFHINYLGSDQPTFTLNFSKGSYQIIAQYYQLIRLGFQGYKSIMENCMANAKVLTEGIT
KMGRFDIVSKDVGVPVVAFSLRDSSKYTVFEVSEHLRRFGWIVPAYTMPPDAEHIAVLRV
VVREDFSHSLAERLVSDIENVLKELDTHPPPLPTKAARVTAEEVHNDKGDGLHQFHTDIV
ETQKDILKHWRKIAGKKTSGVC
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggtagtaacaacgacgtcaattagtgactcaaacgagaacttgcactgtacatttgcg
tcaagatatgtacaagaatctttgcctaagttcaagatcccaggcaggtccatgcctaag
gaagccgcttttcagattgttaacgatgagcttatgttggacggtaatcccaggttgaat
ttagcctcctttgttagcacgtggatggagcccgagtgcgacaagcttatcatgtcttcc
attaataagaactacgttgacatggatgagtaccctgttactactgaacttcagaatcgg
tgtgttaacatgttagcacatcttttccatgctccagttggtgacgatgaaaccgcaata
ggagttggtacagtgggttcatcagaggcaatcatgcttgctggccttgctttcaaacgc
aaatggcaggcgagaagaaaagcagaaggcaaacctttcgataagcctaatatagtgact
ggagctaatgtacaggtctgctgggaaaaatttgcaaggtactttgaggttgaattgaag
gaggtaaaattaaaagaaggatactatgtaatggaccctgctaaagcagtagagttggta
gatgagaatacaatatgtgttgctgcaattcttggttccactctgactggggaatttgag
gatgtaaagctccttaacgagttgcttgtaaaaaagaacaaggaaactggatgggatacg
ccgatccatgttgatgctgccagtggaggatttattgctcctttcttgtggccagatctt
gaatgggatttccgcttgcctttggtgaaaagtataaacgtcagtggtcacaagtatgga
cttgtatatgctggtgttgggtgggtaatatggcggagcaaggaagatttgcccgaggag
cttgtgtttcatataaattacctcggatctgatcagcctacttttactctcaacttctct
aaaggttcctatcaaataattgcccagtattatcagttaataaggcttggctttcagggt
tataagagcatcatggagaattgcatggcaaatgcaaaagtactaacggagggaatcaca
aaaatgggccggtttgatatcgtctctaaggatgtaggcgtgcctgtagtagcattttct
ctgagggatagcagcaaatatacagtgtttgaagtgtctgagcatcttagaagattcgga
tggattgtcccagcatacaccatgccaccagacgctgaacacattgctgttctgcgtgtt
gtggttagagaggatttcagccacagcttagctgagagactagtatccgacattgagaat
gttctgaaagagttagatacacatccacctcccttacccacaaaggctgcccgtgtcact
gcagaggaagtgcataatgataagggtgatgggcttcatcagtttcacacagatattgta
gagactcagaaagacatactcaagcattggaggaaaatagcagggaagaagaccagcggg
gtctgttaa

DBGET integrated database retrieval system