KEGG   Nicotiana sylvestris: 104215577Help
Entry
104215577         CDS       T05026                                 

Definition
(RefSeq) uncharacterized protein LOC104215577 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy03030  DNA replication
nsy03410  Base excision repair
nsy03420  Nucleotide excision repair
nsy03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    104215577
   03410 Base excision repair
    104215577
   03420 Nucleotide excision repair
    104215577
   03430 Mismatch repair
    104215577
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nsy03032]
    104215577
   03400 DNA repair and recombination proteins [BR:nsy03400]
    104215577
Enzymes [BR:nsy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     104215577
    6.5.1.6  DNA ligase (ATP or NAD+)
     104215577
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     104215577
DNA replication proteins [BR:nsy03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    104215577
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     104215577
DNA repair and recombination proteins [BR:nsy03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     104215577
   NER (nucleotide excision repair)
    Other NER factors
     104215577
   MMR (mismatch excision repair)
    Other MMR factors
     104215577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_N DRMBL RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 104215577
NCBI-ProteinID: XP_009763722
UniProt: A0A1U7V6D1
LinkDB All DBs
Position
Unknown
AA seq 1067 aa AA seqDB search
MSSDAGTLTLDSTTLYTTALSSLPGQSSSHSNPPPLPLPALPPSVPQPKLIPKTRFIIDG
FKYAGDFSVSYFLSHFHSDHYTGLSPNWSKGIIFCSSITANLLIQVLNVPAQFVVSLPLS
EAVLIDGSEVFLIDANHCPGAVQFLFKNPVNYGKFERYIHTGDFRYCDKMKLEPVLNAFV
GADAVFLDTTYCNPKFIFPSQDESIDYIVGVIEKYGAENEGSLKHILFLIATYVIGKERI
LVEVAWRCKRKIHVDGRKIAVLKVLGHGEDGVFTTFESETDVHVVGWNVLGETWPYFRPN
FVKMNEIMREKGYSKVVGFVPTGWTYEVKRNKFSVRKKDSFEIHLVPYSEHSNYDELRQY
VKFLKPKRVIPTVGIDVEKLDSKHANAMRKHFAGLVDEMSIKQEFLMGFHRCVQGEEDMD
AKESPNASISITNQENRGESAHALVSITKQENEDTSLDSKICNNGDREDIIHSFPQGEPE
LQGLEKISEGDVEEELKELKDCLPIWVTKDQMLDLLSISGKNIVDAVTNFYEHETEYRER
VTVSNSPTSSFEPNSPNGFALPFNPKGDESMLSPKPWVGKSPQQGETTASNKTFKLPNMN
RSSCKTIFPGKRKRSAENKSLKKARGNVSMEPGGSKQCTITKFFSKKPPPSVQNGNGATA
SRNSHDDNSVLLSASVESYKEEADRFIQIVNGDESLRSYAATVLAKTKGDISMALDIYFS
EHKDVGCGISESSKVVQPAKEVFPSSKDEKLPKKLGNDPDLSLSGVPLANTAVNYVSLPP
EKYSPLEHASWSKGQAAPYLHLSRTFELVEEEKGKIKVTSMFCNMFRSLLALSPEDVLPA
VYLCTNKIAPDHENTELNIGGSTVIAALEEACGTKRSKVRELYNSLGDLGDVAQLCRQTQ
SLLAPPVALTIRGVYSTLRRISLQAGSGSGVRKKSLIVNLMCSCREKEMKFLVRTLVRNL
RIGAMMRTVLPALAQAIVFNSLLYDGPVENMKENLQRLSAEAVEAYNILPSLDVLVPSLM
EKGIEFSSNTLSMDPGIPIKPMLAKITNGAPQVLKLFQNKAFTCEYK
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgatgccggaaccctaacccttgactctaccactctctacacaaccgctctt
agttccctccccggtcaatcttcctcacattcaaacccaccacccctccctcttccggct
ctccctccctcagtcccccaaccgaaactgattccaaaaactcgttttatcatcgacggt
ttcaaatatgccggcgatttctcagtttcgtacttcctctctcatttccactccgatcac
tatactggcctgtcccctaattggtccaaaggtatcattttttgctcctccataaccgct
aaccttctcatccaagtcctcaatgttcccgcgcaatttgtagtgtctttaccgctctcc
gaagccgttttaatcgacggctccgaggtatttctcatcgacgccaatcattgtcctggt
gctgtgcagtttttatttaaaaatccagttaattatggcaaatttgagcggtatattcac
acaggtgattttcgttattgtgacaaaatgaaattagagcctgttttaaatgcatttgtt
ggtgctgatgctgtatttttagatacaacttactgtaatccgaaatttatattccctagt
caagatgagtcaattgattatatagttggtgttatagagaaatatggagctgagaatgag
ggttcattgaaacatatattgtttcttattgctacttatgttattgggaaggagaggatt
ttagtggaggttgcgtggagatgtaagagaaagatccacgttgatggcaggaaaatagca
gttttgaaggtattaggtcatggggaggatggggtgtttactacctttgaatctgaaact
gatgttcatgttgttgggtggaatgtgttgggtgagacttggccatatttcagacccaat
tttgtgaaaatgaacgagatcatgagagagaaagggtattccaaggtggttggttttgtc
ccaactggctggacttatgaagtgaagcgaaataagttttctgtgaggaagaaagattcc
tttgagatacatcttgttccatatagtgaacattctaattacgatgagcttagacaatat
gtgaagtttctgaaaccaaagcgtgtcataccaacagtaggcatagatgttgagaagctg
gatagcaaacatgccaatgccatgcggaagcattttgctggcttggtcgatgagatgtcc
attaagcaagaatttctaatgggttttcatcgttgtgtccaaggggaggaagatatggat
gcaaaagaatctcctaatgcttcaattagtatcaccaatcaagaaaacagaggcgaatct
gctcatgctttagtcagtatcaccaagcaagaaaatgaggatacttcattggattctaag
atctgcaataatggtgatagggaggatattatccattcatttcctcaaggagaacctgag
ttgcaaggtttagaaaaaataagtgaaggcgatgtggaagaagagctgaaagaacttaaa
gactgtttacccatttgggtcactaaagaccagatgctggatttacttagtatttcgggg
aaaaatattgttgatgcagtcactaacttttatgaacatgaaaccgaataccgcgaacgg
gtcactgtcagtaattctcctacctcttcatttgagccaaattcaccaaatgggtttgca
ttgccttttaacccaaaaggagatgaatctatgctgtctcccaaaccatgggttggtaaa
agcccgcagcagggtgagacaactgcatcaaataaaacctttaaattgcccaacatgaac
cgttccagttgcaaaactatttttccgggtaaaaggaagagaagtgctgaaaacaagtcg
cttaaaaaagcaagaggaaatgtaagtatggaacctggtggatcgaagcagtgtactata
acaaagttcttcagtaaaaagcctcctccatccgtgcagaatggtaatggtgcaactgct
agtagaaattcccacgatgataacagtgtgctactaagtgcctccgttgagtcttataaa
gaggaagctgatcggtttattcagattgtgaatggggatgagtctttaagaagttatgct
gccacagtactagcaaagactaaaggagacataagtatggcacttgacatttatttttca
gaacacaaagatgttggatgcgggatttctgaaagcagcaaagtggtgcaacctgctaaa
gaggttttcccttcttccaaagatgaaaagttgcccaaaaaattaggaaatgacccggat
ttatccttgtctggagttcccttagccaatactgctgtaaattatgtatcacttccacct
gagaaatattctcctttggaacatgctagctggagcaaggggcaggctgctccataccta
catctttcacggacttttgaattggtagaggaagaaaaaggcaagataaaagtaacatca
atgttctgcaatatgtttcggagcttgcttgcattgtctcctgaggatgtgcttcctgca
gtgtacttgtgcacaaacaagatagctcctgaccatgaaaatacggaattgaatattggg
ggcagtactgttatagcagcacttgaggaggcatgcgggacaaagagatcgaaagtacga
gaactatataacagcctaggtgatcttggtgatgttgctcaactttgccgacaaacacaa
tcgttacttgctcctccagtggcacttacaattaggggtgtatactctactcttagaagg
ataagtttacaggcaggtagtgggagtggcgtccgaaagaaaagcctcattgtcaatctc
atgtgttcatgtagggagaaggagatgaagtttcttgtcagaactttggtcaggaatttg
cggattggagccatgatgagaactgttcttcctgcattagctcaagctattgtgttcaat
tctcttctttatgatggaccagtcgaaaacatgaaagagaatctgcagcgactttcagca
gaagcagttgaagcatataacatccttcccagcttggatgtacttgttccttctttgatg
gaaaaggggattgagttttcctcaaatacgttgtcaatggatccaggcatacccatcaaa
ccaatgcttgcaaaaattactaatggcgcccctcaagtgctgaagctcttccagaacaaa
gcctttacatgcgagtacaagtaa

DBGET integrated database retrieval system