KEGG   Nicotiana sylvestris: 104220839Help
Entry
104220839         CDS       T05026                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00052  Galactose metabolism
nsy00500  Starch and sucrose metabolism
nsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104220839
   00500 Starch and sucrose metabolism
    104220839
Enzymes [BR:nsy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     104220839
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 104220839
NCBI-ProteinID: XP_009770102
UniProt: A0A1U7VQB5
LinkDB All DBs
Position
Unknown
AA seq 906 aa AA seqDB search
MKPTQFPSLLGNTFFLVFLLLQLSIFSPHSATSIKEQEAQQQVGYGYSITSAALDSSGNS
LFAHLQLINNSSVFGPDIQNLILIASLETNDRLRIRITDVNHQRWEVPEEILQRPPPPSP
PSTTHFLSESQSSSTLSNQNSDLEFTLHNTTPFSFTVRRRSTGDTLFDTSPXSQNPTSTF
LIFKDQYIQISSSLPPTRANLYGLGEHTKSSFKLTHNQTLTLWNADIGSSNIDLNLYGSH
PFYMDVQSSANESDAGVSHGVLLLNSNGMDVVYTGDRISYKMIGGLIDLYFFAGPSPEMV
VDQYTQLIGRPAAIPYWSFGFHQCRWGYKNIDDVELVVDSYAKAGIPLEVMWSDIDYMDG
FKDFTLDPVNFPLDRMKFFLRKLHHSGQKYVLILDPGISINNTYDTYRRGMEEDVFIKCG
NMPDQGVVWPGNVYYPDFLNPASGIFWRKEIEKFHNLVPFDGLWLDMNELSNFITSPPTP
SATNDDPPYKINNSGDHLSINYRTVPATSTHFRNTMEYNVHNLYGLLESRATYNALVNAT
GKRPFILARSTFLGSGRYTSHWTGDNAATWNDLAYSIPTVFSFGLFGIPMVGADICGFSV
NTTEELCHRWIQLGAFYPFARDHSANDTTRQELYIWESVAEASKKVLGLRYQLLPYFYML
MYEAHTKGTPIARSLFFSFPQDTNTYDISTQFLLGKGIMISPVLKQGAXSVDAYFLAGNW
FDLFNYSRFASLNQGKYMTLDAPPDHINVHVREGNILAMQGEAMTTQGARRTAFKLLVVL
SSSGNSTGELFVDDDDEVQMGRDGGRWTIVRFNSNITGNKIVIKSEVVNGGYALDQGLVL
EKVTLGLKNVRGLKGYELVGCMGSDKQGNTRMKKSIEPSGQFVTMEISGISILVGKEFKL
ELYVSI
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaacacaatttccatctttactcggaaacaccttctttttagtcttccttttg
ctacagttatcaatcttttcgccccattctgcaacatccattaaagagcaagaagctcaa
caacaagttggctatggttactcaatcacatctgcggccttagattcctctggaaattca
ctttttgctcatcttcaactcatcaacaactcttcagtttttgggcctgatattcagaat
cttatcctcatcgccagtttggaaacaaacgaccgtctccgaatacgaataacggacgtt
aaccaccaacggtgggaagtgccggaagaaatcctccaacgtccaccaccgccgtctccg
ccgtcaaccactcatttcttgtcagaaagccaatcctcatccaccctctcaaatcaaaac
tcggacctagaattcaccctccacaacaccacccctttcagcttcactgtccgccggcgc
tccaccggcgatactctctttgacacatcgccgtagtcccaaaaccccaccagtacattc
ctcatattcaaagaccagtacatacaaatctcctcctcattaccacccactagagccaac
ctttacggcctcggagaacacacaaaaagctcgtttaagctcacgcacaaccagactttg
actctgtggaatgctgacatcgggagttccaacattgaccttaatctctatgggtcccat
cctttttacatggacgtccagtcgtcggcgaatgaatcggacgctggagttagtcatggg
gttttacttctgaatagcaatggcatggatgttgtgtatacgggtgataggatcagctat
aaaatgatcggagggttgattgatttgtatttctttgccggaccttcgccggaaatggtg
gtggatcagtatacgcagcttattggtcgccctgctgctataccatattggtcttttggt
tttcaccaatgccggtggggttacaagaacattgatgatgttgaactggtagtggatagt
tatgcaaaggctgggatccccctggaggttatgtggagtgatattgattacatggatggt
tttaaggacttcacgcttgatccagttaacttcccattggatcggatgaaattttttctc
aggaagctccatcatagtggtcagaaatacgtacttatattagatccaggtattagtatc
aataatacatatgacacctataggagaggcatggaagaagatgtcttcataaaatgcggt
aatatgcccgatcaaggggttgtttggccagggaatgtttactatcctgattttctaaat
ccagctagtggaatattttggagaaaagaaattgagaagttccacaatctcgtacctttt
gatggtctgtggcttgacatgaatgaactatctaatttcataacttcccctcctacacca
tcagcaaccaatgatgaccctccctataagataaacaactctggcgatcacttgtccatc
aattatagaacagttccagccacttccacacattttagaaatactatggagtataatgtc
cataacctttatggattactagaatccagagctacttataatgctttggttaatgccact
ggtaaaagaccattcattcttgcaagatcaacttttcttggctctggcagatatacgtcc
cactggactggagataatgctgcaacctggaatgatttagcatactccattcctactgtc
tttagttttggactatttggaattccaatggttggagcagatatatgtggtttttcagtg
aacactactgaagagctttgtcaccgctggattcagcttggagcattttatccatttgca
agagaccactctgctaatgacactacccgccaggagctctatatttgggagtcagttgct
gaagcatccaagaaagtccttgggctccgatatcagttacttccatacttttacatgctg
atgtatgaggcacatacaaaagggactcccattgcacgatcacttttcttctctttccct
caagacaccaacacatatgatatcagcacgcagtttcttcttggtaaaggtatcatgatc
tcacctgtacttaagcaaggagcancctcagttgatgcatatttccttgctggaaactgg
tttgacctcttcaattactctcgtttcgcgagtttgaatcaaggaaaatatatgacactt
gatgcaccaccagatcatataaatgtacacgttcgtgaagggaacatattggccatgcaa
ggggaagcaatgacaacacaaggtgctaggaggactgcattcaagctccttgtcgtgctg
agcagcagcggaaacagcaccggagaactatttgtggacgacgatgatgaggtgcagatg
ggaagagacggaggaaggtggacaatagtcaggtttaacagcaacatcactggcaataaa
attgtgattaaatcagaggttgtgaatggaggatacgcgctcgatcaaggattggtcctt
gaaaaggtgacactgggattgaaaaatgtgagaggattgaagggctatgagcttgttggc
tgcatgggatcagacaagcaaggaaacacaagaatgaagaaaagtattgaaccaagtgga
cagtttgttactatggaaatctcagggatttcaatattggttggaaaggagttcaaatta
gagctatacgttagtatttaa

DBGET integrated database retrieval system