KEGG   Nicotiana sylvestris: 104223336Help
Entry
104223336         CDS       T05026                                 

Definition
(RefSeq) histone-lysine N-methyltransferase ASHH3-like
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nsy00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    104223336
Enzymes [BR:nsy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104223336
Chromosome and associated proteins [BR:nsy03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104223336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 104223336
NCBI-ProteinID: XP_009773063
UniProt: A0A1U7W389
LinkDB All DBs
Position
Unknown
AA seq 375 aa AA seqDB search
MIEPMPAMKKSAVHGGIGHVFNKLTSEIGDPVDFELPDWLNKWQPTPFTYIKRNIYLTKK
VKRRLEDDGIFCSCSSTAGSSDVCGRDCLCSILWSSCSSGCKCGSACLNKPFHQRPVKKM
KIVMTEKCGSGIEAGEDIKRKDFVIEYVGEVIDDKTCEERLWKMKHSGETNFYLCEINRD
MVIDATYKGNKSRYINHSCCPNTEMQKWLMDGETRIGIFATRDIKKGEHLTYDYQFVQFG
ADQDCHCGAVKCRRKLGIKPKKRKLSSSDAALKLVACQVAASSPKVKALLSLKHGCQTGV
PPKGSWNCDSAQRIQRPRNCVGHLIRIIRSSDQRSFGIIKQFDSITKKHLIMFEDGSVEY
VDMSTEDWEFCNFLV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgattgaacccatgccagctatgaagaagagtgctgtccatggtgggattgggcatgta
ttcaacaaattgacaagcgagattggagatcctgttgactttgaacttccagattggttg
aataaatggcaacccacaccctttacctatataaagcgtaatatatacctcaccaagaag
gttaagcggcggctggaagatgatggcatattttgttcctgcagttcaacagcaggatct
tcggacgtgtgcggcagggattgtctgtgtagcattttatggtctagctgctcctcaggg
tgtaaatgtgggagtgcttgtctgaacaaaccattccatcaacgtcctgtgaagaagatg
aaaatagttatgactgagaaatgtggcagtgggattgaggcaggtgaagatatcaagaga
aaagattttgttatagaatatgttggagaagttattgatgacaaaacatgtgaagagaga
ctttggaaaatgaagcatagtggggaaacaaacttttacttgtgtgagatcaatcgggat
atggtgattgatgccacttacaagggcaacaaatccagatacattaatcatagctgttgt
ccaaatactgagatgcagaaatggttgatggatggtgagacaagaattggcatatttgcg
acacgtgacattaaaaagggcgagcatctgacctacgattatcagttcgttcaatttggt
gcagatcaagattgccactgtggtgctgtaaaatgtaggcgaaagctgggaattaaacct
aaaaaacgaaaactttcctcttcagatgctgcattaaagttagtggcatgtcaagttgct
gcgtcctctcccaaagtgaaagcattgctatctctaaaacatggttgtcaaactggagtt
cctccaaaaggaagttggaattgtgactctgctcagagaatccagcgtcctcgtaactgc
gtaggtcatcttataagaataattcgctcctctgatcaaaggtcttttggaattataaaa
cagtttgacagcatcaccaaaaaacatttgatcatgtttgaagatggtagtgttgagtac
gttgacatgtcaacggaagattgggaattttgtaactttcttgtgtaa

DBGET integrated database retrieval system