KEGG   Nicotiana sylvestris: 104224084Help
Entry
104224084         CDS       T05026                                 

Definition
(RefSeq) thymidine kinase-like
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00240  Pyrimidine metabolism
nsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    104224084
Enzymes [BR:nsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     104224084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14
Motif
Other DBs
NCBI-GeneID: 104224084
NCBI-ProteinID: XP_009773952
UniProt: A0A1U7W1N8
LinkDB All DBs
Position
Unknown
AA seq 232 aa AA seqDB search
MTFSSSVKDPICVTTKPNYRPTGEIHVIIGPMFAGKTTALLRRVKLESNDGRNVVMIKSS
KDTRYAVDAVVTHDGTKFPCWALPDLSSFKHRFGLDAYEKVDVIGIDEAQFFDDLYDFCC
NAADLDGKTVIVAGLDGDYLRKSFGSVLDIIPLADTVTKLTARCELCNKRAFFTFRKTSE
TETELIGGADLYMPVCRQHYVNGQSVNEAAKMVLDFHKLPSSLILETTLVTP
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaccttttcatcttctgttaaagacccaatatgtgtaaccacaaagcccaattatcgg
ccgaccggcgaaatccatgttattattggtcctatgtttgctggaaaaacaactgctctt
cttcgccgtgtcaaattggaatctaacgacggcagaaatgtggtgatgataaagtcaagc
aaagatacaagatatgcagtagatgcagtagtgacacatgatgggacaaaattcccatgt
tgggcattacctgatctttcatctttcaaacacagatttggactagatgcatatgaaaag
gtcgatgtgattggcattgatgaagctcagttctttgatgacctttatgatttctgctgc
aatgctgctgatcttgatgggaagactgtaattgttgcaggcctagatggcgattacttg
aggaaaagttttggatcagtgcttgacataattccacttgctgatactgtgacaaagttg
acagccagatgtgaactatgtaacaaaagggcatttttcacctttagaaagactagtgag
acagaaactgagcttataggtggtgctgatttatacatgcctgtttgccgtcagcactat
gtcaatggacaatctgtcaatgaagctgcaaaaatggttcttgattttcataaactgcca
agtagccttatattagaaacaactctagttactccataa

DBGET integrated database retrieval system