KEGG   Nicotiana sylvestris: 104226043Help
Entry
104226043         CDS       T05026                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104226043
Enzymes [BR:nsy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     104226043
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 104226043
NCBI-ProteinID: XP_009776228
UniProt: A0A1U7WC48
LinkDB All DBs
Position
Unknown
AA seq 220 aa AA seqDB search
MAAHTIFTTTTSTTNSLLFSIAAPNTNPSPSLHSSFDGVSLNLKSKTPQSLTLSAATAPK
LLTVFAATKKAVAVLKGNSNVEGVVTLSQDDDGPTTVKVRITGLTPGLHGFHLHEFGDTT
NGCMSTGPHFNPDGKTHGAPEDEIRHAGDLGNIVANADGVAEATIVDNQIPLTGPNSVIG
RALVVHELEDDLGKGGHELSLTTGNAGGRLACGILGLTPI
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggccgcccacacaatattcaccaccaccaccagcactaccaattctttgttattctca
atcgctgcccctaacaccaacccctctccttcacttcactcttctttcgacggtgtttcc
ctcaatctcaagtcaaagactccccaatctttgacactttctgctgccactgctcctaaa
cttctcactgtttttgctgctactaagaaagctgttgctgtccttaagggaaattccaat
gttgagggcgttgtcactctctcccaagatgatgatggtccaaccactgtgaaagttcgc
ataactggacttacacctggacttcatggattccatttacacgagttcggtgacactaca
aacgggtgtatgtctacaggaccccatttcaatcctgatggcaagacacatggagctcct
gaagatgaaatccgtcatgcgggtgacctgggaaacatagtggccaatgccgatggtgtg
gctgaagcaacaattgtagataatcagataccattgactggtccaaattcagttattgga
agagcacttgtggttcacgagcttgaggatgaccttggaaagggtggccatgaactcagc
cttaccactgggaatgctggtggacgattggcatgtggcatacttggtttgactccaata
tga

DBGET integrated database retrieval system