KEGG   Nicotiana sylvestris: 104229812Help
Entry
104229812         CDS       T05026                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic-like
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00010  Glycolysis / Gluconeogenesis
nsy00020  Citrate cycle (TCA cycle)
nsy00620  Pyruvate metabolism
nsy01100  Metabolic pathways
nsy01110  Biosynthesis of secondary metabolites
nsy01200  Carbon metabolism
Module
nsy_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104229812
   00020 Citrate cycle (TCA cycle)
    104229812
   00620 Pyruvate metabolism
    104229812
Enzymes [BR:nsy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     104229812
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 104229812
NCBI-ProteinID: XP_009780823
UniProt: A0A1U7WQG3
LinkDB All DBs
Position
Unknown
AA seq 466 aa AA seqDB search
MASLLQSKSPALSFSSTISSPSSLRSSAAATAAAFPRQYKLPVVQSKIREIFMPALSSTM
TEGKIVSWTKSEGDVLSKGESVVVVESDKADMDVETFYGGILAAIVVNEGETAPVGAPIG
LLAETEDEIAEAKVRAKGQSELETSPAATTTSDAAAAAPKVAPPHGQIKIVATPYAKKLA
KQHKVDINKVTGTGAFGRITPEDVEKAAGLXPKSNPAATAVAAPIPAAAAPAKASPTSFP
DIPGSTVVPFTTMQIAVSKNMMESLSVPTFRVGYPVSTNALDALYEKVKPKGVTMTALLA
KAAAMALAQHPVVNATCKDGKSFTYNSSINIAVAVAINGGLITPVLQDADKLDLYLLSQK
WKELVDKARAKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGAVMAVGASKPTVVSD
SEGFFSVKNKMLVNVTADHRIIYGADLAAFLQTFSKIVENPESLTM
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcttctccaatccaagtcgccagctctctcattctcctccacaatctcttct
ccttcttccctccgatcttccgcggcggcgacggcggcggcattccctcgccaatacaaa
ctccccgttgtccaatcgaagatccgtgagattttcatgcccgctctcagttctaccatg
accgaaggcaaaattgtctcctggactaagtccgagggtgacgtactctccaaaggagaa
tctgttgtggtcgttgaatctgataaagctgacatggatgtagagacattctacggtggc
attctcgctgctatcgttgtcaatgagggcgaaaccgctcctgttggcgctcctattggg
ctattagctgagactgaagatgaaattgccgaagccaaggttagagccaaaggccaatcc
gaactagaaacctctcctgctgctaccactaccagtgatgctgccgctgctgcccccaaa
gttgctccgcctcatggacagattaagattgtcgccacgccttatgcgaagaagttagcg
aagcagcacaaagttgatatcaataaagtgactgggacgggggcatttggaaggattaca
ccggaggatgttgagaaggctgcgggattanctcctaaaagcaaccccgctgccactgca
gtagctgctccgatcccagctgcggctgctcctgcaaaagcgtctccaactagctttcct
gacattccagggtcgaccgttgttcctttcaccacaatgcaaattgcagtatcaaagaat
atgatggagagcctctctgttcccacattccgtgttggatatccagttagtaccaacgcc
cttgatgcgctgtatgaaaaggttaagccaaaaggtgttacaatgactgcactgttagct
aaagctgcagcaatggccctggctcaacatcctgttgtgaacgccacttgtaaagacgga
aagagctttacatataatagcagtataaatattgctgttgctgtggcaattaatggtgga
ttgatcaccccagtgcttcaggatgctgacaagttggatctttatctattgtctcaaaag
tggaaggaattggtagacaaggctagggcgaagcaacttcagccacacgagtacaattca
gggactttcacgttgtccaacttaggcatgtttggtgtggacagatttgatgctattctt
cctcccggccagggggctgttatggctgttggagcatcaaaaccaactgttgtctctgac
tctgaaggtttcttctctgtcaaaaacaagatgctggtgaatgtcacggcagatcaccgg
attatttatggtgctgacttggcagccttccttcaaacattctcaaagattgttgagaac
ccagagagcttgacaatgtag

DBGET integrated database retrieval system