KEGG   Nicotiana sylvestris: 104233317Help
Entry
104233317         CDS       T05026                                 

Definition
(RefSeq) uncharacterized protein LOC104233317
Organism
nsy  Nicotiana sylvestris
SSDB OrthologParalogGFIT
Motif
Pfam: RVP zf-CCHC DUF1086
Motif
Other DBs
NCBI-GeneID: 104233317
NCBI-ProteinID: XP_009785008
UniProt: A0A1U7X2F2
LinkDB All DBs
Position
Unknown
AA seq 1263 aa AA seqDB search
MIPHQIDFSPGSRARIYIQKEFFSEKWNQFKTWFFDTYSKEDLSNISQEFYETCALHNQI
MYFVPWFITTYLPLYIKVLERSYKDGSGNITKAIYPPQAPFILPNNTGITFTAFQKFIDD
NVAAISIAEINKLISQNNYLGLYVKILGEHIGSLDKKLDDLTILIKKMGTKKGPTDIAST
SGSKTVDQNILTHIQRPPEIQDFKFKSLDDLAQLLDKKLSGLNIRPIDLSKNFADKMETV
SDYKTETWSEFNKLKGIVKQNHRYADKPRMQTYYYPRPTPQDVLIEERDWNQTNTSYNGS
EIYEWNLDGLTDRQLTILVHRMLMYSTICKSVKNTDRTICKMIIAGFTGQLRGWWDNHLS
VEEKAFVINATATDEGVDNIGMALVVGREDAVYTLILTILEHFNGRFTSNHQTVRTLLNG
LRCKTLSEFRWYKDTFMSRVMELPENRYEHWKAKFIDGLPSLFAERVRNVLKGSCGEILY
NNYTYGKLIGVCTEEGLKLCNELRLSRQLKIDKLKERSQVGDFCTQFGLPGTSTQNRKKK
TKYHRYPNPDSPYKKKRSRYRPKEERDTRKANRKSTRFAKNRSKRDLADIKCYKCGKFGH
ISPNCKLQKLKTLELDDELHDKVYGLLYTSGSESDYYSETESEAEVELIDFSDNNKNVDT
ACTACKGDICACDSDEFYKLKSQFDDLNIKTITSDNVIELLKEVTDEKLREKIITLAASS
SSSSSKTVEKYKNEFEHFAPYSLSEINRRLQKSSTPSRDTSFDDLKEEIENLKRDIKSLK
QNQMICDHRITQIEKNNSLPESSTKGFSDFSNDKGKEISDEKSDLFLGMMQIVTAHKWYI
KCTILIDNNFSITDIAMIDSGADVSCIQEGLIPTRYFQKTTHLVKSASGHALDIEYKLPN
THICQNKVCIPHFFFLVKNQLYPPIILGTPFINAIYPFNNIDKHGFSATYQDKKISYSFV
TDPVTRDINALINMKQRHVDSLQLEILSMNIFDTIQSAKVQQKIKLIAEKMAVDVCADHP
SAFWNRKRHIVTLPYEETFSEDDIPTKSRPCQMNAELVEFCKNEIDSLLQKGLIKPSKSP
WSCSAFYVNNAAEKERGIPRLVINYKPLNKHLKWIRYPIPNKRDLLSRLYDANIFSKFDL
KSGYWQIQIFKEQMDPSWVTRGRAPQKRIVEESTVKHIARRISIQDGDKMDLINQYLEGL
KRNLLQSLDQCEKSDTSMRSETSGDDLVEDTQPIQPEMILSDREIDKVEEFLQQMQNMDK
KKT
NT seq 3792 nt NT seq  +upstreamnt  +downstreamnt
atgattccacaccaaattgattttagcccaggttctcgggcccgtatttatattcaaaaa
gaattttttagtgaaaaatggaaccagtttaaaacatggttttttgatacttatagtaaa
gaggatttgagtaatatatctcaagaattttatgaaacttgtgccttacataatcaaatt
atgtattttgttccttggtttataacaacttatttacctctttatataaaggtattagaa
agatcttataaagacgggagtggtaatattactaaagcaatttatccgcctcaggctccc
tttattttacctaataatactggtattactttcactgcctttcaaaaatttattgatgat
aatgtggcagctattagtattgcagaaattaataaattgatttctcaaaacaattatttg
ggtttatatgttaaaattttaggagaacatattggttctcttgataaaaaacttgatgat
ttgactattttaataaaaaaaatgggtactaagaaaggaccaactgatattgcctccact
tcaggaagtaaaacagttgatcaaaacattcttacccatattcaaagacctcctgagatt
caggattttaaatttaaatctcttgatgacttagctcagcttttagataaaaagctttct
ggtttaaatattagacctattgatttatcaaaaaattttgctgataaaatggagaccgtt
tctgattataaaactgagacttggtcagagtttaataaactcaaagggattgttaaacaa
aatcataggtatgctgataaaccgagaatgcagacctattattatcctcgtcctactcct
caagatgtgttgattgaggaacgagattggaatcagactaatacgtcttataacggttcc
gaaatttatgaatggaatcttgatggtctaactgatagacaattaaccattctcgtacac
agaatgctcatgtattcgactatctgtaaaagtgttaaaaatacagatagaactatttgc
aaaatgattattgcaggttttactggccaacttcgtggctggtgggataatcatttatct
gtagaggaaaaggcgttcgttataaatgctacggcaaccgacgaaggtgttgataacata
ggtatggctctagtagtgggtagagaagatgcagtttatactcttatccttacaatttta
gagcatttcaacggtagatttacctcaaaccatcagaccgtccgaactttacttaatgga
cttagatgtaagacccttagtgagtttagatggtataaagatacttttatgagtagagtt
atggaactacccgagaatagatatgagcactggaaagccaagtttatagacggcctccct
tccttatttgctgaaagagtaaggaatgtgttaaagggtagttgcggagagattctgtat
aataattatacctatggtaagcttataggtgtttgtacagaagaaggtcttaaattatgt
aatgagctaagactttctagacagcttaagatagataagcttaaagaaaggtcccaagta
ggtgacttttgtacccagtttggtttacccggaacttccactcaaaataggaagaagaaa
accaaatatcataggtaccctaacccggatagcccgtataagaaaaagaggtctagatat
aggcctaaggaagaacgtgatactagaaaagcgaacaggaaatctactcgatttgcgaag
aatagatccaaacgtgatctcgctgatattaagtgttataagtgtggaaagtttggtcat
atttctccaaactgcaagcttcaaaagctaaaaaccttagaactcgatgatgagttacac
gataaggtttatggcttgttatacacttcgggatcagaatctgactattactcagagact
gaatctgaagctgaagttgagttaattgatttttctgataataataaaaatgttgatact
gcttgcactgcttgcaaaggtgatatttgtgcttgtgatagtgacgaattttataaattg
aaatcacaatttgatgatcttaatataaaaactattacatctgacaatgtaatagaactt
ttaaaagaagttactgatgaaaaacttcgtgaaaaaattattactttagctgcaagttca
agttctagtagttcaaaaactgttgaaaaatacaaaaacgaatttgaacactttgcacca
tattctttatctgaaataaatagaagacttcaaaagtccagtactcctagtcgagatact
tcttttgatgatttaaaagaagaaatcgaaaatttgaaaagagatattaagtctcttaag
caaaatcaaatgatttgcgatcaccggattactcaaattgagaaaaataattctctacct
gaatcttcgactaaaggattttctgatttttctaatgataaaggaaaagaaatttctgat
gaaaaatctgatttatttttaggtatgatgcaaattgttactgcacacaaatggtatatt
aaatgtactattttaattgataataatttttctataactgatatagctatgattgatagt
ggtgcagatgtaagctgcattcaggaaggattgattcctactagatattttcaaaagact
actcatttggtgaaatccgcttctggtcatgctttagatatagagtacaaattgcctaat
actcatatttgccagaataaagtctgtattccacatttcttctttttggtaaaaaaccag
ttataccctccaatcatacttggaacaccttttattaatgctatttatccgtttaataat
atagataaacatggtttttctgctacttatcaagataaaaagataagctattcctttgtt
acagatcccgtaactagagatattaatgccttgattaatatgaaacaaaggcatgttgat
tcactacaattagaaattcttagtatgaatatatttgatactatacaatctgcaaaagtt
cagcagaagattaaattaattgctgaaaaaatggccgttgatgtttgcgccgatcaccct
agtgccttttggaacaggaaaaggcatattgtaactcttccatacgaagaaaccttctct
gaggatgatattcctactaaatctcgaccttgccagatgaatgctgagctagttgaattc
tgcaaaaacgagattgatagtttgttacaaaagggtttgataaaaccctcaaaatctcct
tggtcatgttctgccttttatgttaataatgcggcagagaaggaacgaggtattcctcgc
ttagtcataaattataaaccattaaataaacatctgaaatggattaggtatcctatccct
aacaaaagggacttgctatccagattatatgacgccaatatattttcaaaatttgattta
aaatctggttattggcaaattcaaatatttaaagagcaaatggacccttcatgggtcacc
cggggcagagcccctcaaaaaaggatagtagaagaaagcactgttaaacatattgctcgg
agaatatcaatccaagatggagataaaatggatttgataaatcaatacttagaagggttg
aaaagaaatctgctccaatcactagatcagtgtgaaaaatcagacacttcaatgagaagt
gagacgagtggtgatgacctcgtagaagatactcaacctatacagccagaaatgatatta
tctgacagagaaattgacaaggtggaagaattcctccaacagatgcaaaatatggacaaa
aagaagacttga

DBGET integrated database retrieval system