KEGG   Nicotiana sylvestris: 104233985Help
Entry
104233985         CDS       T05026                                 

Definition
(RefSeq) methionine gamma-lyase-like
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00270  Cysteine and methionine metabolism
nsy00450  Selenocompound metabolism
nsy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    104233985
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    104233985
Enzymes [BR:nsy01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     104233985
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5 Met_gamma_lyase
Motif
Other DBs
NCBI-GeneID: 104233985
NCBI-ProteinID: XP_009785770
UniProt: A0A1U7XH28
LinkDB All DBs
Position
Unknown
AA seq 436 aa AA seqDB search
MADKLQQNAIVSNQKRSASDEHDHRDDFKHHLIWEDPAAALADIRHEFGEHGGVNMSIEA
SATFTVMDPETLSRMFAGELGPDRDFFIYSRHFNPTVLNLGRLMAALEGTEAAYCTSSGM
SAIASVMLQLCSSGDHVVASRSLYGGTHALLTHFLPRTSNITTSFVDIRDFDMINEAIVK
GKTKVLYFESISNPTLTVSNIPELCRIAHDKGVTVVVDNTFAPMVLSPARLGADVVVHSI
SKYISGGADVIAGAVCGPASLVNSMMDLRQGALMLLGPTMNAKVAFELSERLPHLGLRMK
EHCDRALIFATRMMNLGLKVIYPGLENHPDNALLKSMANKNYGYGGILCLDMGTEERANR
LMNVLQNCTQFGFMAVSLGYYETLMSCSGSSTSSEMNNQEKELAGISPGLIRMSVGYNGT
MEQKWSQLEKALSEMQ
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atggcggataaattacaacaaaatgcgatcgtttcaaaccagaagagatcggcttccgat
gaacatgatcatcgtgacgacttcaagcaccacctcatatgggaggatccagcggcggcg
ttagcagatatccgccacgaatttggcgaacatggcggagtcaacatgtccatcgaagcc
tccgccacattcaccgtcatggacccggagactttgagccgcatgtttgcgggcgaactc
ggccctgaccgtgatttcttcatttatagccgtcatttcaaccctaccgtcctcaacttg
ggccgcctcatggcggccttagagggtaccgaggccgcctactgcacgtcctcgggcatg
tcagctatcgcatccgtgatgctccagctctgtagctcgggggaccatgtggtggcctcc
cgttccttgtacggcgggacacatgctttgctcacgcattttttaccgaggacgtctaat
ataacgacgtcgtttgtggacattagggattttgatatgattaatgaagcaattgtgaaa
gggaaaacgaaggtgttgtattttgagtcaatttcaaatccgacgttgacggtttcgaac
attccagagttgtgtaggatagcgcatgataagggggtgacggtggtagtggacaacacg
tttgctccgatggtgttgtctccggcgaggttgggagccgacgtcgttgttcatagtatc
tctaaatatattagcggtggtgccgatgtcattgcaggtgcggtttgtggaccggcaagt
ctggtgaactcgatgatggatcttcgtcaaggtgcactgatgctactaggcccaaccatg
aacgcgaaggtcgcgttcgaactgtcagaaagactgccccacttaggcctaagaatgaaa
gagcattgcgatcgagcactcattttcgctactagaatgatgaatctcgggctcaaagtc
atttacccaggtctagaaaatcacccagataatgcccttctcaagtccatggcgaataaa
aactacggctacggtggaattttgtgtctggacatgggaactgaggaaagagcaaaccgt
ttgatgaatgttttgcaaaattgcacacaatttgggttcatggctgtgagtttgggctat
tatgagacacttatgtcatgttcgggcagtagtactagtagtgaaatgaataaccaagag
aaggaattggctgggatttcgcctggattgataagaatgtcagttggctataatggtacg
atggagcaaaaatggagccagctcgagaaagcattgtccgaaatgcaatag

DBGET integrated database retrieval system