KEGG   Nicotiana sylvestris: 104235287Help
Entry
104235287         CDS       T05026                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein AIM1-like
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00071  Fatty acid degradation
nsy00592  alpha-Linolenic acid metabolism
nsy01100  Metabolic pathways
nsy01110  Biosynthesis of secondary metabolites
nsy01212  Fatty acid metabolism
Module
nsy_M00087  beta-Oxidation
nsy_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    104235287
   00592 alpha-Linolenic acid metabolism
    104235287
Enzymes [BR:nsy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     104235287
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     104235287
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     104235287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 NAD_binding_7 MORN
Motif
Other DBs
NCBI-GeneID: 104235287
NCBI-ProteinID: XP_009787311
UniProt: A0A1U7XCC7
LinkDB All DBs
Position
Unknown
AA seq 710 aa AA seqDB search
MAKKASINMEIGNDGVAVITVHNPPVNALTLSALEELKRCYQEAIDSDTVKAIVLSGADG
RFCGGLDISVVENVHKHGDISLLPDASIGLVVNKMENGKKPSVAAIQGFALGGGLELAMG
CSARIATAKADLGLPELKLGVIPGCGGTQRLPRLVGTSKAVDMLMSSKTITSEEGKELGL
IDAIVSSEELLAVARCWALDIVEGRQPHCNSLEKTDKLGPKDESLEILKSARQRYRAPHY
SACLDVIEEGIISGGFSGVLKEDKVFKELVLSNTAKGLLHVFLAERATSKVPGVTDIGLK
PRRIEKVAVVGGGLMGSGIATALIMSNMNVVVKEINHEYLLKAMKSVEANLQGLVTRGQL
NQDKMKRTLSLLKGTLDYEDLKDVDMVIEAVNEVVSLKQSIFEDIEKVCSPDCIFASNTS
TISLDVIGERTSSQDRILGIHLFSPAHVMTLVEIVRTENTSPQVIVDVIRFTKTMKKVPI
VVKNCTGFAVNRSFFPYMQGPDLLANLGVDIFRVDRVITEFGMRLGPFQLQDLSGYGIFL
AGVKEFVAAFPDRAFQSPLVQLMVENGREGKKNGKGYYTYKKGSKPEADHSVIQVVEESM
RFTNIAPGGKPISVTDEEILEMIFFPVVNEACRVIEEGIVVRASDIDIASVHGFKFPSET
GGVMFWADTIGSEYIYSKLKTWHEAYGDFYKPSTFLEQRAAKGLPLGGSC
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaagcatcaatcaatatggaaatagggaacgatggcgtggctgttattact
gtccataatccacctgtcaatgccttaactctctcagcacttgaggagttgaagagatgc
tatcaagaggcaattgatagcgacaccgtaaaggccattgttctttctggtgctgatggt
agattttgtggtggtttggacatcagtgttgtggagaatgttcataagcatggagatata
tcacttctacctgatgcatcaattggactcgtggttaataaaatggaaaacgggaagaag
ccttctgttgctgcaattcaaggatttgcccttggtggtggcttggagttggctatgggg
tgcagtgctcgaattgccacagcaaaagctgatcttggtttacctgagctgaaacttgga
gttattcctggatgtggaggcacccagaggcttccaagattagtcgggacctcaaaggct
gttgatatgttgatgtcatccaaaaccataacttctgaagagggaaaggagttgggtctt
attgatgccattgtctcttctgaggagctattggcagttgctcggtgctgggcacttgac
atcgttgaagggcgccaaccacattgcaattctcttgaaaagacagataaacttggacct
aaggatgaatcgctcgagatactgaaaagtgctagacaacggtacagagcgcctcattac
agtgcctgtcttgatgtgatcgaagaaggcatcatatctggaggattttctggtgttctt
aaggaggataaagtatttaaagagctggtgctgtcaaatactgcaaaaggtcttcttcac
gtatttctcgctgaacgtgcaacatcaaaggtaccaggtgttactgatattgggctaaag
ccgcggagaatagaaaaagttgccgttgttggtggcggtttaatgggatctggcattgct
acagctctcattatgagcaacatgaatgtcgtagttaaagaaattaaccatgaatatctg
ttgaaagcaatgaaatcggtagaagcaaatctacaaggcctagtaacaagaggacagctg
aatcaggataagatgaaaaggactttgtctcttctcaaaggcactttagactatgaggat
ctaaaagatgttgacatggtcattgaggctgttaatgaggtagtgtctctgaaacaatca
atatttgaagatattgaaaaagtttgttctccagactgcatttttgcatcaaacacatct
acaattagtcttgatgttattggggaaagaacaagtagtcaagatcgcattttggggata
catttattcagtcctgctcatgtgatgactctggtggaaatcgtgaggaccgaaaatact
tctccacaagtaattgttgatgttataagattcaccaagactatgaaaaaagtccccatc
gtagtgaaaaattgtactggttttgctgtcaaccggagcttcttcccttatatgcaagga
ccagacctgttggcaaatttaggtgttgatatcttcagagttgaccgcgtgatcactgag
tttggcatgcggcttggccctttccagcttcaggatcttagtggctatggtatatttttg
gctggtgtaaaagagtttgttgctgcttttccagaccgtgcttttcagtcacccttggtt
caactgatggtagaaaatgggcgggaaggtaagaagaatggaaaaggatattacacatac
aaaaagggaagcaagccagaagctgatcactctgtgattcaagttgttgaggagtctatg
cgatttactaatattgctcctgggggaaagccaatatctgtgaccgatgaagaaattctt
gaaatgatattctttcctgtggtgaatgaggcttgtcgagttattgaggaaggaatagtt
gtccgagcatctgatattgatattgcatctgtccatgggtttaaatttccctcagaaact
ggaggtgtcatgttttgggctgatacaattggatctgaatacatatactcaaagctaaaa
acttggcatgaggcctatggtgatttctataagccatcaacatttttggagcagagagct
gcaaaaggattgcccttgggaggatcgtgttga

DBGET integrated database retrieval system