KEGG   Nicotiana sylvestris: 104241425Help
Entry
104241425         CDS       T05026                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00020  Citrate cycle (TCA cycle)
nsy00190  Oxidative phosphorylation
nsy01100  Metabolic pathways
nsy01110  Biosynthesis of secondary metabolites
nsy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104241425
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    104241425
Enzymes [BR:nsy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     104241425
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 104241425
NCBI-ProteinID: XP_009794664
UniProt: A0A1U7Y5Z6
LinkDB All DBs
Position
Unknown
AA seq 630 aa AA seqDB search
MWRCVSRGLRASSNRSISGGGHFRRLFSSQTANVGGSSYTVVDHTYDAVVVGAGGAGLRA
AIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQ
DAIQYMCREAPKAVIELENYGLPFSRTENGKIYQRAFGGQSLDFGKGGQAYRCACAADRT
GHALLHTLYGQAMKHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFRAASTILA
TGGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEGSRGEG
GILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEV
LKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDNPDAVVPG
LMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGENQKPLEKDAGERTIA
WLDKIRNSNGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCQLIDKTWESFHDVQLKDR
SLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWE
NEKVRLEYRPVHMNTLDDEVETFPPKARVY
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgtgtgtcgcgtggccttcgcgcttcctccaacagatctatctccggcggc
ggccattttcgccgacttttctcctcacagactgcgaatgtgggaggatcgtcgtatacg
gtggtggatcacacatacgatgcagtggtggtaggtgcaggcggtgcagggcttcgagcg
gcaatagggttgtctgagcatggattcaatactgcttgcataaccaagctctttcctact
cgatctcacaccgttgcagctcagggcggtataaatgcagcattaggcaatatgacagag
gacgattggaggtggcacatgtatgatacagttaaaggaagtgattggttaggtgatcag
gatgctatccaatacatgtgtagagaagcgcccaaagcagttatagagcttgagaattat
ggtttgcctttctctcgaactgaaaatggtaaaatatatcaacgtgcatttggtggtcaa
agcctagactttggaaaaggaggacaagcatatcgttgtgcttgtgctgccgatcggact
gggcatgctctattgcatactctttatgggcaggccatgaagcataatacacagtttttc
gtggaatattttgctttggatttactaatgaacagtgatgggagctgccaaggtgtaata
gcactaaatatggaggatggtaccttgcatcggttccgtgctgcctctactattttggcc
acagggggttatggtcgagcttacttctctgcaacatctgctcatacttgcaccggagat
ggtaatgctatggtcgcgcgtgctgggcttcctcttgaggatcttgagtttgtgcagttt
catccaactggtatatatggagctggttgtctcattactgaaggatctcgtggtgaaggt
ggtattctgaggaatagtgagggtgagcgatttatggaaaggtatgccccaacagccaag
gatcttgcgtcaagagatgttgtttccagatctatgacaatggaaattcgagaagggcgt
ggtgtaggaccattgaaggatcatatctatcttcacctcaatcacttacctccagaggtc
cttaaggagagacttcctggtatctctgaaacagctgcaatttttgccggtgttgatgta
actaaggagccaattcccgttttacctaccgtgcattataatatgggaggaattcccaca
aattaccatggagaggtggtcactattaaaggagataatcctgatgccgtggttcctgga
ctgatggctgctggtgaagcagcatgtgcatcagttcatggtgccaatcgtcttggtgca
aattctcttctagatattgttgtttttgggcgggcatgtgctaatagggttgctgaaatc
caaagaccaggagagaaccagaagccacttgagaaggatgcaggagagaggaccattgca
tggttggacaagattaggaactcaaatggttcactgcctacatcaaagattcggctgaat
atgcagagagttatgcaaaacaatgctgctgtgttccgcacacaagaaacactagaggaa
ggttgccagctcattgacaaaacatgggaaagtttccatgatgttcagttgaaggataga
agtttaatatggaactcagatcttatagagactattgagctggaaaaccttttgatcaat
gcatgcatcaccatgcactcagccgaggctagaaaggaaagcagaggagctcacgctcgt
gaagattttacgaaaagagatgatgagaagtggatgaaacatacactaggatattgggag
aacgagaaggtccggctagagtacagaccagttcatatgaacactctagatgacgaggtc
gagacattcccacccaaggcacgtgtctattga

DBGET integrated database retrieval system