KEGG   Nicotiana sylvestris: 104244020Help
Entry
104244020         CDS       T05026                                 

Definition
(RefSeq) histone-lysine N-methyltransferase family member SUVH9-like
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    104244020
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nsy03036]
    104244020
Enzymes [BR:nsy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     104244020
Chromosome and associated proteins [BR:nsy03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     104244020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA Pre-SET SET
Motif
Other DBs
NCBI-GeneID: 104244020
NCBI-ProteinID: XP_009797624
UniProt: A0A1U7YEE5
LinkDB All DBs
Position
Unknown
AA seq 682 aa AA seqDB search
MGSLVPFQDLNLQPESTNLTSNSPTPLITPKIEPKLEPLDEFTQADLQTPPLFSNPNTPN
FNSNFTPNSLSHSSIITSEQNPSGSNETNVYSEYNRISELFREAFAKRMQRYGDIEIVAD
PENDDTRDVEVDLDNSRAIVPVNNEDNQVSEMVIPRRKYQQRSSELVRVTDLKPEDQRYF
RDAVRRTRMLYDSLRVLAMVDDENNMSVVPHRKTRGDLKACQVLREHGLWMNRDKRIVGA
IPGVFIGDVFFFRMELCVVGLHGQVQAGIDYVPASQSSNREPIATSVIVSGGYEDDQDGG
DVIIYTGHGGQDKLSRQCMHQKLECGNLALERSMHYGIEVRVIRGFKYEGSASGKVYVYD
GLYRIVECWFDVGKSGFGVYKYKLVRIENQEELGSAILRFAQNLRIRPLVARPTGYVSLD
ISRKKENVPVFLFNDIDDNHDPAYFDYLLKTVFPPYVYQNVGSGNGCECVNGCVDNCFCA
MRNGGQFAYDYNGILVRGKPLVFECGPHCQCPPTCRNRVSQKGLRHRFEVFRSRETGWGV
RSLDLIQAGSFICEFTGVVLTREQAQIFTMNGDSLVYPNRFPERWAEWGDLSQIYPDYVR
PAYPSIPPLDFAMDVSRMRNVACYMSHSSSPNVLVQPVLYDHNNVSFPHLMLFAMENIPP
LREISLDYGVADEWTGKLAICN
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgggttctcttgtcccatttcaagaccttaatcttcaacctgaatccaccaatttaacc
tctaattctccaactccgttaattacccccaaaattgaaccaaaacttgaaccactggat
gaatttactcaagctgatcttcaaaccccacctcttttctccaaccctaatactcccaat
ttcaactccaatttcactcctaattcactatcacacagctcaattattacatctgaacaa
aacccatctgggtctaatgaaacaaatgtgtattctgagtataacagaatttctgagctg
tttcgtgaagcttttgctaaacgaatgcagcgttacggagatattgagattgttgctgac
cctgagaatgatgatacccgtgacgtcgaggtggacctggataattcacgtgccattgtt
ccggttaataatgaggataatcaggtttcggaaatggtaattcctagaagaaaatatcaa
caaagatcatctgaattagttagggttacagatcttaaacctgaagatcaacgttatttt
cgtgatgctgttaggagaactcgaatgctgtatgattcattacgtgttttagcgatggtg
gacgatgagaataacatgagtgtggtgcctcataggaagactagaggtgatttgaaggct
tgtcaggttttaagagaacacgggttatggatgaatcgcgataagcgaattgttggggcg
atcccgggggtgtttattggtgatgtgttctttttcaggatggagctttgtgttgttggt
ttacatgggcaggttcaagctggcattgattatgtccccgcgagtcagagctcaaatagg
gagccgattgctactagtgtgattgtttcgggtggatacgaggatgatcaggatggtgga
gatgtgattatatataccgggcatggtggacaggataagttgtcgaggcaatgtatgcat
cagaagctggaatgtggaaatttggcgttggagcggagtatgcactatggaattgaggta
agggtaattcgcggctttaagtacgaaggtagtgctagtggtaaagtttatgtgtatgat
ggattgtatagaattgttgaatgttggtttgatgttgggaagtctggatttggagtgtat
aagtacaagcttgttaggattgagaatcaggaagagttgggaagtgccattcttaggttt
gcgcagaatcttaggattagacctttggtggcaaggcctacggggtatgttagtctagat
atatcgaggaaaaaagaaaacgtgccggtatttcttttcaatgatatcgatgataatcat
gatcctgcttactttgattatctgttgaagactgtttttcctccgtacgtgtaccagaat
gtgggcagtggaaatggctgtgagtgcgttaatgggtgtgtggataattgtttttgtgct
atgagaaatggtggccaatttgcctatgattataatgggatattggtgagaggcaaaccg
ttagtgtttgaatgtggaccacattgtcagtgtcctccaacttgccggaatcgagtgagt
caaaagggtttgaggcacagatttgaagtgtttcggtctagagagactggttggggagtt
aggtcattggacttgatccaagctgggtccttcatctgtgaatttactggggtcgtactc
acacgagagcaagcccaaatttttacaatgaatggtgatagtttagtctatccaaatcgc
tttcctgagaggtgggcagaatggggagatttgtcccaaatatatcctgactatgtgcgg
ccagcatacccctccattcctcctctggatttcgcgatggatgtgtctagaatgaggaac
gtagcatgttatatgagtcacagttcaagccccaacgtgttggtgcagcccgtgctttat
gatcacaacaatgtatctttcccccacctgatgctctttgcaatggagaatatccctcct
cttagggagatcagtcttgattatggggtagcagatgaatggacagggaagcttgccatt
tgtaattga

DBGET integrated database retrieval system