KEGG   Nicotiana sylvestris: 104246486Help
Entry
104246486         CDS       T05026                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial-like
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00020  Citrate cycle (TCA cycle)
nsy00190  Oxidative phosphorylation
nsy01100  Metabolic pathways
nsy01110  Biosynthesis of secondary metabolites
nsy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    104246486
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    104246486
Enzymes [BR:nsy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     104246486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_7 Fer2
Motif
Other DBs
NCBI-GeneID: 104246486
NCBI-ProteinID: XP_009800601
UniProt: A0A1U7YF66
LinkDB All DBs
Position
Unknown
AA seq 275 aa AA seqDB search
MATGLIRRAISRVHSSPAAKLVVARAHASEAKAHQSESKQQPNIKSFQIYRWSPDNPGKP
ELKEYKIDLKECGPMVLDALIKIKNEIDPSLTFRRSCREGICGSCAMNIDGCNGLACLTK
IDSGAESTITPLPHMFVIKDLVVDMTNFYNQYKSIEPWLKRKTEPPTPGKEIPQSKSDRA
KLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWIMDSRDEYTQERLDAVNDEF
KLYRCHTILNCSRACPKGLNPGKHIQNIKRLELAS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccggtttaatccgacgagcaatttctagggtccactcatcgccggcggcgaag
ctagttgtcgcccgagcacacgcatcggaggccaaagcccatcaatcagaatccaagcag
cagccaaacatcaagtcatttcaaatttaccgatggagtccagacaacccaggtaaaccc
gagctcaaggaatacaaaatcgatctgaaagaatgtggcccaatggtcttagatgcttta
atcaaaatcaaaaacgaaatcgacccatcacttacgtttcgtagatcctgtagagaaggg
atctgtgggtcctgtgctatgaatattgatggttgcaatggacttgcttgtttgactaag
atcgattcgggtgctgaatcgacgattacgccgttgccacatatgtttgtgattaaggat
ctggttgtggatatgactaatttttataatcagtacaagtctattgagccttggttgaag
aggaagacggagccgccgacccctgggaaggagataccgcagagtaagagtgatagggca
aagttggatgggatgtatgagtgtattctgtgtgcttgctgtagcacatcatgccctagt
tactggtggaatcctgagtcttatcttggtccggctgcactgcttcacgctaaccgatgg
attatggatagccgtgatgaatatactcaggagcgcctggacgcagttaatgatgaattc
aagctttatcgctgccatactattctgaactgttctcgtgcttgcccaaagggattgaat
cctggaaagcatattcagaatatcaagcgtctggagcttgcatcttga

DBGET integrated database retrieval system