KEGG   Nicotiana tabacum (common tobacco): 107761656Help
Entry
107761656         CDS       T04643                                 

Definition
(RefSeq) uncharacterized LOC107761656
  KO
K17398  DNA (cytosine-5)-methyltransferase 3A [EC:2.1.1.37]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00270  Cysteine and methionine metabolism
nta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    107761656
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nta03032]
    107761656
   03036 Chromosome and associated proteins [BR:nta03036]
    107761656
Enzymes [BR:nta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     107761656
DNA replication proteins [BR:nta03032]
 Eukaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    107761656
Chromosome and associated proteins [BR:nta03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107761656
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP UAF_Rrn10 SCP1201-deam
Motif
Other DBs
NCBI-GeneID: 107761656
NCBI-ProteinID: XP_016435388
UniProt: A0A1S3X6P7
LinkDB All DBs
Position
Un
AA seq 1033 aa AA seqDB search
MISVMSNGFEANRRNNSVEETKLRVSTTTSSITPADGSRVAMDVKNSRASNSDSRVSNVE
NEGNETTKVRDMKEEGGTNSVKANRVKSEQKGKTTALVSSRTDVKKGKLEPAVSGYDLML
SKFDEFAGNGKSWSVGYGFEMGDMVWGKVKSHPWWPGHIFSEAFATPSVRRSKREGHILV
AFYGDSSYGWFDLDELVHFEPTFAEKSMQTNVKNFVKAVEEGVDEVGRRSALGLVCHCRK
RYKFRSAEVDGFFSVDFSDLEKNCTYSASQIKKARERFQPKETFDFVRKLALKPRSKVHE
TDLNFVKKKATVLAYRKAVFEEFDPTYAEAFGVIPSKQAQEAVAQPFRQPSSRAPLSGRL
VQAETLGKGKSSAKSNKMKDQVEKDRYLFKRRDEPGNLKVQVGAAPAVNSDQPVHLDDSS
LSGKDVSPSAAEHLPSASGSTLIEQPLNPAANVEELHGQRQAEDDGTDVVQPSVPTEAKL
HAGGSRVKKINGGPDKVKIRKRSGEEVSGGSSPSTERKKKKKKKAEGGLNANSNHVEGQV
AVSSDSMVMEKVARESVQVPSASREELQMDIQQKGDATGSSVPDGLVTEDVVRVRSNNIE
LPQVLSDLHALALDPFYGVESSNIKTIRELFLKFRSLVYQKSLALSAAVESESSTPISKS
PVVAHISDTASTNNVKQTSNLKPEKNPARPDDPTKGGRKRGPSDRQEEIAAKKKKKINDV
RALAAQKKASLKASEVQQGESKEIPAKKLSSTQVKVSKPDTGKKKEPDPTMLIMKFPPNG
ALPSIPELKAKFARFGTMDHSATRVFWKSSTCRLVYQYRDHAVGAYRFASASNNLFGNPN
VRCYIREVAAEAQDAETTKVPKEDVAAETSAAKDGAADSRSSTMPGQLKSCLKKPPGEEG
PVSNGGNGSNRASPRVKFMLEEAIIRGEQTNDSRTVNDASSIADRSASSSSNINNYTTQS
SMLPLPTAQYANAPPNDVHFTHQVAHRNVPNYNNQVSVPEVDISQQMLGLLTRCSDIVTD
LTGLLGYVPYHSL
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atgatttctgtgatgagcaacggatttgaagcaaatcgaaggaacaattcagtagaagag
acgaaacttagggtttccaccacaacctccagtatcacccccgctgatggttctagggtt
gctatggacgtaaagaattctagggcttcgaattcggattctagggtttcgaatgtggaa
aacgagggaaatgaaacaactaaggttagggacatgaaagaggaaggaggcacgaactcc
gtgaaagcgaatcgagttaagtcggagcagaaaggtaagacgacagcattagtttctagt
agaactgatgtcaagaagggaaaattggagcctgctgtttctggatacgatttgatgcta
tctaagttcgatgagtttgcagggaatgggaagagttggtcagttggttacgggtttgaa
atgggtgatatggtgtgggggaaggtgaaatcacacccttggtggccaggtcacattttc
agtgaggcgtttgctactccttctgtacgaaggagtaaaagggaaggtcacattttagtg
gccttttatggtgatagtagttatggctggttcgacctggatgagctagtacattttgaa
ccaacttttgctgaaaaatctatgcaaactaatgtgaagaactttgttaaggcggtggag
gaaggggtcgatgaggtgggccggaggagtgctttaggtttggtttgtcattgtaggaag
agatacaaatttcgttctgcggaggttgatgggttttttagtgtagattttagtgatctt
gagaagaattgtacttactctgccagtcagattaagaaggctagggaaaggtttcaaccg
aaagagacatttgactttgtgaggaagttggcgttaaagcctaggagtaaagtgcatgag
accgatcttaactttgttaagaagaaggcgactgtgctggcttataggaaggcagtgttt
gaggaatttgatcctacctatgctgaagcttttggtgttattccttctaaacaagcacaa
gaagcagtggctcagccatttagacagccttcttcaagagctcctttgagtggcagattg
gtgcaggcagaaactctgggtaagggaaagagttctgcaaaatctaataaaatgaaggac
caagttgagaaagacaggtatctatttaaacgcagagatgagcctggtaacctgaaagtc
caagttggtgcagcaccagcagttaattctgaccagccggttcatctagatgattcctcc
ttatcaggaaaagatgtttctcctagtgctgctgagcacctgcctagtgcatctggctcc
accttgattgagcagccattaaatccggcagctaatgtggaagaactgcatggacagaga
caagctgaagatgatggtactgatgttgtgcagccttctgtgcctactgaagcaaagctg
catgcagggggttctcgagtaaaaaaaatcaatggtggaccagataaggtcaagattcgt
aaacgttctggtgaggaagtgagtggtggcagtagtccctcaaccgagaggaagaaaaag
aagaaaaagaaggcggaggggggcttgaatgcaaactctaatcatgtggagggacaagta
gctgtttcttcagatagtatggtgatggagaaagtagctagagagtctgtccaagttcct
tcagcgtctagggaagaacttcaaatggatattcagcaaaagggtgatgccacaggtagc
tctgtgcctgatggtttggtaacagaagatgtggttcgggttagaagcaacaatattgag
cttcctcaagtacttagtgatttacatgctcttgctcttgatccattttatggtgtagag
agcagcaatataaaaacaatacgagaactgttcttgaaattccggtctcttgtctatcaa
aaaagcttggccttgtctgccgcagttgagagtgagtcaagtacccccatcagcaaatca
cctgttgtcgcccatatctcagacactgcctccaccaataatgtgaaacaaacatcaaat
ctaaagccagagaagaatcctgccaggcctgatgatcctaccaaaggagggcgaaagagg
ggtccttcagataggcaagaggaaattgctgccaagaagaagaaaaagatcaatgatgtg
agagcattggcagcacaaaagaaggcttccttgaaggcttcagaagttcaacaaggcgaa
agcaaggaaatacctgccaaaaaactgtcttcaacacaagtgaaagtctctaagccagat
actggcaagaagaaggagcctgacccaaccatgcttattatgaagtttccacctaatgga
gctcttccctccattcctgagctgaaggctaagtttgcccgttttggaactatggatcat
tcagctactcgggtcttctggaagtcatccacctgccgtttggtctaccaatacagggat
catgcagtgggggcctatagatttgccagtgctagcaataatttgtttgggaatcccaat
gtgagatgctacattagagaagtggcagctgaagcacaagacgcagaaactaccaaggtg
ccaaaggaagatgttgccgccgagacttctgcagcaaaagatggggcagctgattcgagg
tcctcaacaatgcctgggcagctgaaatcatgtctaaagaaacccccaggtgaggaaggg
ccagtgagcaatggtggtaatggtagtaatagggcatcaccccgtgtaaaatttatgttg
gaagaagctattattagaggcgagcagacaaatgatagtaggaccgtcaacgatgctagt
agtattgctgatcgaagtgcatcttctagttctaatatcaacaattatacaactcagtcg
tccatgctccctcttcctactgctcaatatgccaatgcacccccaaatgatgttcacttt
actcatcaagtagcccatagaaacgtgcccaattataacaatcaagtgtccgttcctgaa
gttgatatttcacaacaaatgctaggccttctcaccaggtgtagtgacattgtgaccgat
ctgacgggtttattgggctatgtcccttaccattccctttaa

DBGET integrated database retrieval system