KEGG   Nicotiana tabacum (common tobacco): 107763683Help
Entry
107763683         CDS       T04643                                 

Definition
(RefSeq) protein SET DOMAIN GROUP 41-like
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00310  Lysine degradation
nta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107763683
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nta03036]
    107763683
Enzymes [BR:nta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     107763683
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     107763683
Chromosome and associated proteins [BR:nta03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107763683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 107763683
NCBI-ProteinID: XP_016437655
UniProt: A0A1S3XCI9
LinkDB All DBs
Position
Un
AA seq 657 aa AA seqDB search
MEVRATKDIPIGQDLNPPIPPLSLSLHYSTLLSHCSSCFSPLPSSPFSPTNNPSPNHFIR
YCSLQCSSHDSPLHFSSSEFHFFHLFPEPLFTTSPTSTDLRLSLRLIHRFQEASGSFSNL
ERICGLMTNFKKIMFLEEQQCYNDDNEEELSGRILDGAKAMAIARRTRDGLDTNVELSAA
EYSVEAAVLCLVLTNSVEVHDKDGRSLGVGVYDLAFSYINHSCSPNACYKFCTTLDSGGE
LEFRICPAASETGAAGNESESIINGSESCGPRIVLRSIKAIQKSEEVLITYTDLLQPKVM
RQSELWSKYRFSCCCKRCNAMPTTYIDHCLQEILSSNLGDNFDGNLVMEKLVDCLDNAID
DFLSFSNPKSCSEKLEILLTQDHVDIVLTPNGENIRQLFRLHPLHHVSLHAYMTLASAYK
VVGSDLLALDSESDKHQCEAFSMSRKSAAYSLLLAGATHHLLESESSLIVPLSNFWATAG
ETLLSLVKSSRWNSFAKGRQIEEIIFSSCQICGKCTLLDRFRDTCANIHDRNAEFAEITS
EFLNCITDITPKIWGFLIEEGGGYLNVVEDPINFRWLESRTSSVTHFATHATSGNAKETN
SGFEVVQYHREMRVNLFQLSIHCLLYGAFLSTICFGPHSPLMSKVENLLSHEDILNG
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atggaggttcgagcaacaaaagatattcccatagggcaagacctcaatcctccaatccca
cccctttctctttccctccactattccactctcctctctcactgctcttcttgcttttct
cctctcccttcttctcctttctcccctacaaataatcccagcccaaatcacttcattcgc
tactgttcccttcaatgctcttctcacgactcccctcttcatttctcctcttcagaattt
cacttctttcaccttttcccagaaccccttttcaccacctcccctacttccaccgacctc
cgcctctccctccgcctcatccaccgcttccaggaagcaagtgggtctttctcaaatttg
gaaagaatttgtgggttgatgacaaatttcaaaaaaattatgttcttggaagaacaacag
tgctacaacgatgacaatgaagaagaactttctggaagaattcttgatggggcaaaggct
atggctattgcaagaagaactcgagatggtttggatactaatgtggagttatcagctgcg
gagtattctgtagaagctgcagtgctctgcttggtgctgactaattcggtggaagttcat
gataaggatggcagaagtttaggagttggtgtttatgatttagccttttcgtatatcaat
catagctgttctccaaatgcttgttacaagttttgtacaacattggattctggtggagaa
ttggagtttagaatatgtccagcagcttcagagactggtgctgctggtaatgaaagtgaa
tccattattaatggaagtgaatcatgtggtccgagaatagtacttcgaagtataaaggcg
atccagaaaagtgaagaggtgttgattacatacactgacttattacagcctaaggtgatg
aggcagtcagagttgtggtcgaagtacaggttcagttgctgctgtaaacgatgtaacgca
atgcctacaacttatatagatcactgtctgcaagaaattttaagttcaaatctcggtgac
aactttgatgggaatcttgtaatggagaagctggtggattgcttggataatgctatagat
gactttctctcatttagtaaccccaagtcttgtagtgaaaagctcgagatcctgcttact
caagatcatgttgacattgttctgacaccgaatggtgaaaacatacgtcaactcttcaga
ttgcatcctcttcaccatgtctctttgcatgcctacatgacactggcttctgcatataaa
gtcgttggaagtgacctgctggccctagattctgaaagtgataaacatcaatgcgaagct
tttagtatgagcagaaagagtgcagcatattccttgttacttgctggtgcaacccaccat
ttattagaatctgaatcttctctcattgtgcctttgtcaaatttttgggcgactgctggt
gagaccttactaagtcttgtcaaaagctcaaggtggaactcatttgcaaaggggagacag
attgaagaaattatattttcgtcatgtcaaatttgtggcaaatgcacgctacttgatagg
tttagggatacttgtgcaaatattcatgaccgaaatgcagaatttgctgagataactagc
gaatttttgaactgtattaccgatataacaccaaaaatctggggttttctcattgaggaa
ggtggtggttacttgaatgtagtcgaggatcccattaactttagatggctcgagagtaga
acgtcatctgttactcattttgcaactcatgctacaagtggtaatgcaaaggaaacaaat
tccggatttgaagtagtacaatatcacagagagatgagggtaaatctattccagcttagt
attcactgcttactctatggagcatttttgtcaactatatgttttggtcctcattcgcca
ctgatgtctaaagtcgaaaatcttctaagtcacgaagatattctgaatggttaa

DBGET integrated database retrieval system