KEGG   Nicotiana tabacum (common tobacco): 107764742Help
Entry
107764742         CDS       T04643                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 4 of pyruvate dehydrogenase complex, chloroplastic-like
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00010  Glycolysis / Gluconeogenesis
nta00020  Citrate cycle (TCA cycle)
nta00620  Pyruvate metabolism
nta01100  Metabolic pathways
nta01110  Biosynthesis of secondary metabolites
nta01200  Carbon metabolism
Module
nta_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107764742
   00020 Citrate cycle (TCA cycle)
    107764742
   00620 Pyruvate metabolism
    107764742
Enzymes [BR:nta01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     107764742
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-GeneID: 107764742
NCBI-ProteinID: XP_016438830
UniProt: A0A1S3XFZ4
LinkDB All DBs
Position
Un
AA seq 465 aa AA seqDB search
MASLLHSKSPALSFSSTISSPSSLRRFSSSAAAFPARQYKLPAVQSKIREIFMPALSSTM
TEGKIVSWTKSEGDVLSKGESVVVVESDKADMDVETFYGGILAAIVVNEGETAPVGAPIG
LLAETEDEIAEAKIRAKGQSATPKLETSPAATTTSDAAAAAPKVAGLIKIVATPYAKKLA
KQHKVDINKVTGTGAFGRITPEDVEKAAGITKSIPAATAVAAPIPAAAAPAKASPTSFPD
IPGSTVVPFTTMQITVSKNMMESLSVPTFRVGYPVSTNALDALYEKVKPKGVTMTALLAK
AAAMALAQHPVVNATCKDGKSFTYNSSINIAVAVAINGGLITPVLQDTDKLDLYLLSQKW
KELVDKARAKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGASKPTVVSDS
EGFFSVKNKMLVNVTADHRIIYGADLAAFLQTFSKIVENPESLTM
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcttctccattccaagtccccagctctctcattctcctccacaatctcttct
ccttcttccctccgacgtttctcatcttccgcggcggcattcccagctcgccaatacaaa
ctccccgctgtccaatcgaaaatccgtgagatcttcatgcctgctctcagctctaccatg
accgaaggcaaaattgtctcctggactaagtccgagggtgacgtcctctccaaaggagaa
tctgtggtggtcgtcgaatctgataaagctgacatggacgtagagacattctacggtggc
attctcgctgctatcgttgtcaatgagggcgagacggctcctgttggcgctcctattggg
ctcttggctgagactgaagatgaaattgccgaagccaagattagagccaaaggccaatct
gctactcccaaactagaaacctctcctgctgctaccactaccagtgatgctgctgctgct
gcccccaaagttgctggactgattaagattgtcgccacgccttatgcgaagaagttagcg
aagcagcacaaagttgatataaacaaagtgactgggactggggcatttggacggattacc
ccggaggatgtcgagaaggccgcagggattactaaaagcatccccgctgccactgcagta
gctgctccgatcccggctgcggctgctcccgcaaaagcgtctccaactagctttcctgac
attccagggtcgaccgttgttcctttcaccacaatgcaaattacagtatcaaagaatatg
atggagagcctctctgttcccacattccgtgttggatatccagttagtacgaacgccctt
gatgctctgtatgaaaaggtcaagccaaaaggcgttacaatgactgcactgttagctaaa
gctgcagcaatggccctggctcaacatccagttgtgaacgccacttgtaaagacggaaag
agctttacttataatagcagtataaatattgctgttgctgtggcaattaatggtggattg
atcaccccagtgcttcaggatactgacaagttggatctttatctattgtctcaaaagtgg
aaggaattggtagacaaggctagggctaagcaacttcagccacacgagtacaattcaggg
actttcacgctgtccaacttaggcatgtttggtgtggacagatttgatgctattcttcct
cccggccagggggctattatggctgttggagcatcaaaaccaactgttgtctctgactct
gaaggtttcttctctgtcaaaaataagatgctggtgaatgtcacggcagaccaccggatt
atttatggtgctgacttggcagccttccttcaaacgttctcaaagattgtcgagaaccca
gagagcttgacaatgtag

DBGET integrated database retrieval system