KEGG   Nicotiana tabacum (common tobacco): 107765055Help
Entry
107765055         CDS       T04643                                 

Definition
(RefSeq) dnaJ protein ERDJ2A-like
  KO
K09540  translocation protein SEC63
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta03060  Protein export
nta04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:nta00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    107765055
   04141 Protein processing in endoplasmic reticulum
    107765055
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:nta03110]
    107765055
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:nta02044]
    107765055
Chaperones and folding catalysts [BR:nta03110]
 Heat shock proteins
  HSP40 / DNAJ
   107765055
Secretion system [BR:nta02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   107765055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec63 DnaJ Sporozoite_P67 DUF2457
Motif
Other DBs
NCBI-GeneID: 107765055
NCBI-ProteinID: XP_016439134
UniProt: A0A1S3XGP7
LinkDB All DBs
Position
Un
AA seq 681 aa AA seqDB search
MADSGENSALFPIFILSVIALPLVPYTILKLLRAASKRDKSIHCECSVCSRSGKHHKSIF
RRISSFLTCSNLTVLLLWVIVAFLVYSIKQSSREIEAFDPFSILGLEPGVSESVIKKAYR
RLSIQYHPDKNPDPAANKYFVEYISKAYQALTDPVSRENFEKYGHPDGRQGFQMGIALPQ
FLLDFNGASGGILLIWILGGFILLPMAFGVVYLSRASKYGGNFVRRETLATYFDLVKPSL
APSKVLDVFIKAAEFMDIPVRRADEEPLQELFKLVKSELNLDGKNARQEQAKFWKQHPAL
VKAEMLIQAHLLRKADTFSSNLQQDYKNVLQLAPRLLEGLIKMATVPRTAKGHGWLRPAI
GVIELSQCIIQAVPLSARKAGSGSSDGVASLLQLPHFSDAVITKIGKKVRTLQDLQDMTF
QERAELLSGVAGLSASVLQDVEKVLELMPRATIEVTCETEGEEGIQEGDIVTVQAWVTLR
RANGLISALPHAPYYPFSKGENFWFLLAHTNSNDVWFSESVNFMDEAAAITTASTITEAK
LEASGASMEEITAAVKDAVTKVKSGCRLVLGKIQAPQAGNYNLNCHLMCDTWIGCDTKTN
LKLKILKRSRAGSRGGLVAEGVQGENGLEDEDDIEEDEEGDQSEYSEDEDEDEEEDEAEV
EKKNNNRKGFANGSARRKGRK
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atggctgactctggagagaatagtgccttattccccatttttatattgtcagtaattgcc
ctacccttagtaccctatacaatacttaaattacttcgtgctgcttcaaagagggataag
agtattcactgtgagtgttcagtttgctctcgatctggaaaacatcacaaatccattttt
cgaaggatctctagttttttaacgtgtagcaacctgactgtgctgctgctctgggtcatt
gtggccttccttgtttattccatcaagcaaagtagtcgtgagattgaagcttttgatcca
ttcagtattcttgggctagaaccaggagtttcggaatctgtaataaagaaggcttatagg
agactttcaatacaataccatccagacaaaaaccccgatccagctgctaataagtatttc
gtggagtatatttccaaagcttaccaggcgctgacagatccagtctcaagggagaatttt
gagaaatatggacatccagatggcagacagggttttcaaatgggaattgcacttcctcag
tttctgcttgatttcaatggcgcatctggtgggatattattaatttggattcttggaggt
tttatactgctgcccatggcatttggcgttgtttatctatcaagagcatcaaaatatggg
ggaaattttgtcaggcgtgaaactctagccacttattttgatctagtgaaaccctccttg
gctccaagcaaagttctggatgtcttcattaaggcagctgaattcatggatattccagtt
cgaagagccgatgaagaacctcttcaggaactcttcaaacttgtgaaaagtgaattgaac
ctggatggtaagaatgccaggcaggaacaagcaaaattttggaaacaacatcctgctctt
gttaaggcagagatgttgattcaagcccatttacttcgtaaggcagacactttctctagt
aacttgcagcaagattacaaaaatgtgctgcagcttgcgcctcgtcttctcgaagggctg
atcaagatggcaacagtaccacgcactgctaagggacatggttggctaaggcctgcaatc
ggagtcatcgagctctcccagtgcataattcaggccgttcctcttagtgctagaaaggca
ggttcaggatcctctgatggtgttgcttcacttttgcagcttccacatttcagtgatgcg
gtcatcacaaagatagggaagaaggtgcgtacgctacaggacctccaggacatgaccttt
caagaacgtgccgaactgctttctggtgttgctggcctatctgcttctgtattacaagac
gtggagaaggtactggaattgatgcctcgtgcaacaatagaagttacttgcgagactgag
ggggaggaaggcatacaagagggggacattgtcacagtgcaggcatgggtgacactcaga
cgtgctaatggtttgatctcagcccttccacacgctccatactatccattctccaaggga
gagaatttctggtttttacttgcacataccaattcaaatgatgtctggttttctgaaagt
gtcaactttatggatgaagcagcagccataacaactgcttcaacaataactgaagcgaaa
ctggaagcatcgggggcaagtatggaggagattactgctgctgttaaagatgctgtcacg
aaagttaagagcgggtgtcgactggtgttgggcaagatccaagctccacaggccggaaat
tacaatttaaactgtcatttgatgtgtgacacatggattgggtgcgacacgaagacaaac
ttaaaactaaaaatattgaaaaggagcagagctggaagtcgaggtggtcttgtggctgag
ggagtgcagggggagaatggccttgaagatgaagatgacattgaagaagatgaagagggc
gatcaaagtgagtatagtgaggatgaggatgaagatgaagaggaagatgaggctgaggtt
gagaaaaagaataataacagaaagggctttgctaatggctccgctcgaagaaagggtaga
aaataa

DBGET integrated database retrieval system