KEGG   Nicotiana tabacum (common tobacco): 107765790Help
Entry
107765790         CDS       T04643                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF-like
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107765790
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nta03036]
    107765790
Enzymes [BR:nta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107765790
Chromosome and associated proteins [BR:nta03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107765790
   Polycomb group proteins
    PRC2-EZH2 complex
     107765790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 107765790
NCBI-ProteinID: XP_016439971
UniProt: A0A1S3XJ77
LinkDB All DBs
Position
Un
AA seq 923 aa AA seqDB search
MSSVSDDSPSDCISQPLNDLPNVPPEEATVEPEEVLSVINSLKEKVASERAEYIKKRVDG
NTQKLENLTKDLYNLATERKSLEIFGADRTVDLLSKRQKDAIDMQNGIDTNNGDDDSNSS
EDDGYATSAILLGSSIAVKNAVRPIKLPEEKRIPPYTTWIFLDRNQRMTEDQSVVGRRRI
YYDQNGGETLICSDSDEEVLEEEEEKKVFAESEDYMLRMTIKEVGLSDSVLELLGQCLSR
KPSEVKARYEDLVKKDNAGSSKNEYTESSLDLYLAKDLDAALDSFDNLFCRRCLVFDCRL
HGCSQDLIFPAEKQLPWYCSNADMEPCGPNCYNLAIKFESNATTMICPQSATHGKKSVLP
SDVANNTQMPSRKHVSRRSKSSQGEGAPSNAKNTSESSDSEIRPINNVTPNEHSSSPLKS
KSASKDGSNKRNSKRIAEHVLVAIKKRQKKMTALESDSVASGSLGSKDLNLHCISQKENE
DVSPSSQKTQCNSAKRSRRKNSPVLDSKSSLQGEAFGCQLLEATSDKPVTNYDDSSRKNE
YVGESNCKQEIDSAKSWRPIEKALFEKGLEMFGRNSCLIARNLMNGLKTCWEVFQYMNNS
GNKLFSGACDGMNGGLEGGSNDGQEIMGNEPRRRSKFLRRRGRVRRLKYTWKSAGYHAIR
KRISERKDQPCRQFNPCGCQGPCGKECPCIVNGTCCEKYCGCPKSCKNRFRGCHCAKSQC
RSRQCPCFAAGRECDPDVCRNCWISCGDGTLGVPPQRGDSHECRNMKLLLKQQQKVLLGR
SDVSGWGAFLKNTVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAH
RKGDKLKFANHSPVPNCYAKVMMVAGDHRVGIFANERICAGEELFYDYRYEPDSAPAWAR
KPEASGTRKEDAAPSSGRARKHT
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcggtgtccgacgactccccctccgattgcatatcccaacctttaaatgatctt
ccgaatgtgccacctgaagaagcaactgtagaacctgaggaagtattatcagttattaat
tctttgaaggaaaaagttgcttctgaacgtgctgagtatataaagaaaagggtagacgga
aatacacaaaagttggagaatctgacaaaggatctttacaatttggcaacagagagaaaa
tctcttgagatctttggtgctgacagaacagttgatctactatcgaaaaggcagaaggat
gcaattgatatgcaaaatggcattgataccaataatggagatgatgatagcaatagctct
gaagatgacggatacgccacttctgcaattcttttaggatcaagtattgcagtcaagaac
gccgtacgtcccattaaacttccagaagagaaaagaatacctccatatactacatggatt
ttcttggatagaaatcagagaatgactgaggatcaatctgtggttggtcgtagaagaatt
tattatgaccagaatggtggagaaactttaatttgtagtgatagtgatgaagaagtactt
gaagaagaagaagaaaagaaggtgtttgcagagtccgaagattatatgctgcgaatgacg
atcaaagaagttggcttgtccgacagtgtgttggaattgctaggacagtgcttgtctaga
aaacctagtgaagtgaaggcgagatatgaagatcttgttaagaaagataatgcaggctct
tcaaagaatgagtacacggaaagttctttagatttatatcttgccaaagatcttgatgcc
gctctggattcttttgataatctattttgtcgtcgatgtcttgtctttgattgtagatta
catggatgttcacaggatcttatttttcctgctgaaaaacaactaccatggtactgctct
aatgcagatatggagccctgtggtccaaattgctacaatctggctataaagttcgaaagt
aatgctactacaatgatctgtcctcagagcgctactcatggcaaaaaatctgtcctgcca
tctgacgttgctaataatactcagatgccaagtaggaagcatgtgtcgagaagatcaaag
tcttcacaaggtgaaggtgctccatcaaatgcgaaaaacacctcggagagcagtgattca
gagattagacccataaataatgtcactcctaatgagcactcttcatctccattgaaaagc
aaatctgccagtaaagatgggagcaacaaaaggaacagcaagcgaatagctgaacatgtt
ctagttgccattaagaaaaggcagaagaaaatgacagctttagaatccgactctgttgca
agtggaagtctaggttccaaagatttgaatcttcattgtatttcacagaaggaaaatgaa
gatgtgagtccatcttcacaaaaaacacaatgtaatagtgctaaaaggtccaggaggaaa
aactctccagttttggacagtaaaagttctttgcaaggagaggcttttggttgccaattg
ctggaagctaccagtgacaaacctgtgacaaattatgatgactcgtcgaggaaaaatgaa
tatgtgggtgagagtaactgcaaacaagaaatagatagtgctaaatcttggagacccatt
gaaaaggctctctttgaaaagggtctagaaatgtttggtagaaacagctgtttgatagct
cgaaatctcatgaatggtttgaagacatgctgggaggttttccagtatatgaacaattcc
gggaataagctattctcaggagcatgtgatgggatgaatggcggtcttgaaggtggttcc
aacgatggtcaggaaatcatgggtaatgaacctcgaagaagatccaaatttttacgtaga
agaggcagagttcgccgtttaaaatacacatggaaatctgctggatatcatgcaattagg
aaacggatttctgagaggaaggatcaaccctgtcggcagtttaatccatgtggctgtcaa
ggcccttgtggaaaagagtgtccctgcattgtaaatgggacctgctgcgaaaaatactgt
ggatgcccaaagagttgcaaaaataggtttcgtggttgtcattgtgccaaaagtcaatgt
agaagccgtcaatgcccttgctttgctgcaggcagggaatgtgatcctgatgtttgtcga
aattgttggatcagttgtggtgatggtactcttggggttcctccgcaaagaggtgatagt
catgaatgcaggaatatgaagctacttctcaaacagcaacaaaaggttcttcttggtaga
tctgatgtttctggctggggagctttcttgaagaatactgttggaaagcatgaatacctt
ggggagtacacaggtgaattaatttcacaccgtgaagctgacaagcgcggaaagatttat
gatcgtgaaaattcttcatttctattcaatctaaatgatcagtttgtgcttgatgctcat
cggaagggcgataaactaaaatttgcaaatcattctcctgttccaaattgctatgctaag
gtcatgatggtggctggagatcacagagttggtatctttgccaatgaaagaatttgcgct
ggagaagaactcttttatgattatcgttatgagccagacagtgcacccgcgtgggcgagg
aagcctgaggcatctggtactaggaaagaggatgctgctccttccagtggtcgtgcgagg
aaacatacataa

DBGET integrated database retrieval system