KEGG   Nicotiana tabacum (common tobacco): 107770541Help
Entry
107770541         CDS       T04643                                 

Gene name
Hxk4b
Definition
(RefSeq) hexokinase-2-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00010  Glycolysis / Gluconeogenesis
nta00051  Fructose and mannose metabolism
nta00052  Galactose metabolism
nta00500  Starch and sucrose metabolism
nta00520  Amino sugar and nucleotide sugar metabolism
nta01100  Metabolic pathways
nta01110  Biosynthesis of secondary metabolites
nta01200  Carbon metabolism
Module
nta_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
nta_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107770541 (Hxk4b)
   00051 Fructose and mannose metabolism
    107770541 (Hxk4b)
   00052 Galactose metabolism
    107770541 (Hxk4b)
   00500 Starch and sucrose metabolism
    107770541 (Hxk4b)
   00520 Amino sugar and nucleotide sugar metabolism
    107770541 (Hxk4b)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107770541 (Hxk4b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nta04131]
    107770541 (Hxk4b)
Enzymes [BR:nta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107770541 (Hxk4b)
Membrane trafficking [BR:nta04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107770541 (Hxk4b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 107770541
NCBI-ProteinID: NP_001311993
UniProt: Q6Q8A2
LinkDB All DBs
Position
Un
AA seq 498 aa AA seqDB search
MGKVVVGAAVVCTAAVCAAAVLLMRHKMENSGKWAKAMDILKEFEEKCETPIGKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPTGDETGLFYALDLGGTNFRVMRVQLGGKEKR
IVKQEVKEVSIPKNVMAGSSSDALFDFIATTLVKFVATEGDDFHLPPGRQRELGFTFSFP
VKQLSIASGTLIKWTKGFSIDDAVGQDVVRELTKAMERVGLDVRVAALINDTVGTLAGGR
YNNPDVIAAVILGTGTNAAYVERANTIPKWHGLLPKSGDMVINMEWGNFRSSHLPVTEYD
QSLDAESLNPGEQIYEKMISGMYLGEILRRVLCRMAEEASFFDDYVPPKLKTPFILRTQD
MSAMHHDKSADLKVVGDKLKDILEVPNSTWKMRKIIVELCDIITSRGARLSAAGIVGILK
KLGRDTLKDGEKQRSVIAVDGALFEHYTKFRNCMEGTIKELLGDAAENIVVKLSYDGSGV
GAALLAASHSQYLGLKES
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagtggtggtgggtgcagcagtagtatgtacagctgcagtatgtgctgctgct
gttttattaatgaggcacaaaatggaaaattcaggtaaatgggctaaagctatggatata
ttgaaagagtttgaggagaagtgtgaaactccaataggaaaacttaggcaagtggctgat
gctatgactgtagagatgcatgctggacttgcttctgaaggtggtagcaaactcaagatg
ctcattagctatgttgataacctccccactggggacgaaaccggtctgttttatgcatta
gatctaggcggcacaaacttccgtgtgatgcgtgtgcagttgggcgggaaagaaaagcgt
atagttaaacaagaagttaaagaagtttcaattccaaagaatgtgatggctggatcgtca
tctgacgcgttatttgattttattgccacgacgcttgtaaaatttgttgctacagaaggc
gacgattttcatcttccacccggtagacaaagggagttgggcttcaccttctctttccca
gttaaacaactgtcaattgcatcaggaactcttattaaatggacaaagggcttctctata
gatgatgcggttggccaagatgttgttagagagttaacaaaagcaatggaaagggtcggt
cttgacgtgcgcgtggctgctttgatcaatgatactgttggaacattagcaggaggtcgg
tataacaaccctgatgtcattgctgcagtaatattgggtactggaaccaatgcagcatat
gttgagcgggcaaatacgattcccaaatggcatggtctgctgcctaaatcaggagatatg
gttattaacatggaatggggtaatttccgctcatcacatcttccggtaacagaatacgac
caaagtcttgacgctgagagtttaaacccaggggagcagatttatgagaagatgatttcc
gggatgtatcttggagaaattttgcgcagagtcttgtgtagaatggctgaagaagcttca
ttttttgatgattatgtcccaccaaaactgaaaactccattcattttaaggactcaggac
atgtctgctatgcatcacgacaagtctgctgatctcaaggtggttggcgacaagctgaag
gatatcttagaggtacctaattctacctggaaaatgaggaaaataattgttgagctatgt
gacattattacctctcgtggagctcgtctttctgcagcaggaatcgtgggtatcctcaag
aaattgggaagagacactttgaaggatggagagaagcagaggtcagtaatagctgttgac
ggtgcattgtttgagcattacacaaagttcagaaattgcatggagggaactattaaagag
ttgttgggagacgccgcagaaaacatagtcgttaagctttcgtatgatggttctggtgtt
ggagctgcactattggctgcttctcattcccagtacctcggactcaaggaatcttga

DBGET integrated database retrieval system