KEGG   Nicotiana tabacum (common tobacco): 107777978Help
Entry
107777978         CDS       T04643                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1-like
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107777978
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nta03036]
    107777978
Enzymes [BR:nta01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107777978
Chromosome and associated proteins [BR:nta03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107777978
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA Pre-SET SET
Motif
Other DBs
NCBI-GeneID: 107777978
NCBI-ProteinID: XP_016453641
UniProt: A0A1S3YMX4
LinkDB All DBs
Position
Un
AA seq 711 aa AA seqDB search
MEQGFGSDSVPPAGSIDKSKVLDVKPMRCLMPVFPSPNGMSSVSTPQPSPFVCVPPSGPF
PTGVSPFYPFLAPNAAARSGENHEAFGFGTPISPVPLNSFRTPTANGDTGPRRPGRPRAT
NGLVAEDDGVSDSQNQSDQFGSGYSVHVNDVEDTSTGKKRGRPRKTRMSHPANSHVEVDV
DPILNQLLASFKLVEFDQAKKADGDKELVGRILLAFDVFRRRLTQIDEKRGETPGSARRP
DLKAANLLMTKGARTNQTKRVGNVPGIEVGDIFFFRMELCLVGLHAPSMAGIDYMSVRLT
GDEEPIAVSIVASGGYDDEGDDGDVLIYTGQGGVQRRDGQMFDQKLERGNLALEKSMHRG
NEVRVIRGVIDVTNPRGKIYMYDGLYRIQESWAEKSKLGDCSIFRYKLLRVPGQPEAFTL
WKSIQQWRDGTATRVGVILPDLTSGAESQPVCLVNDVDDEKGPAYFTYIPSLKYSKPYMK
PNPSMGCQCVGGCQPGGSACPCIQKNGGFLPFSSLGVLVSYKTLIHECGSACSCPPNCRN
RMSQTGPKARVEVFKTKNRGWGLRSWDPIRGGGFMCEYAGEVVEESRVGELGNDGDDDYI
FDATRMYEPLEPVRDYNDESKKVPYPLVISAKKGGNVARFMNHSCSPNVFWQLVVRENNN
ETYYHIAFFAIRHIPPMQELTFDYGMVPPDKADCRRKKCLCGSLNCRGYFY
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaggctttggttcagactctgttccaccagcagggtccattgacaagtctaag
gttttagatgtgaagcctatgagatgtcttatgcctgtttttccatccccaaatggaatg
tcgtctgtttcaactcctcaaccctcaccttttgtgtgtgttcctccaagtggtcctttc
ccaactggggtttctccattttatccatttttggccccgaatgcggccgcaagatcaggt
gaaaatcatgaagcttttggttttgggacgcctatatctcctgttcctttaaattcattc
agaactccaactgcgaatggagacaccgggccaaggaggcccggcagacctcgcgctacg
aatggcttagttgcagaagatgatggtgtcagtgattcacagaatcagagcgaccaattc
ggcagtggctatagcgtgcacgttaatgatgtagaagacacaagtacagggaaaaaaagg
ggaagaccgagaaagactaggatgagtcatccagctaattcccatgtcgaagtggatgtc
gatccaatactaaatcagctgcttgcatcctttaaacttgtcgagttcgatcaagctaag
aaagctgatggcgacaaggagctagttgggcgaatactattggcatttgatgtgtttcgt
agaaggttgacccagattgatgagaaaaggggtgagactccaggttctgcaagaaggccg
gacctaaaggctgctaatttactgatgacaaagggagctcggacaaatcagacaaagagg
gttggaaatgtacctgggattgaagttggtgacatattcttcttcaggatggaattgtgt
ctagttggtttgcatgcacctagtatggctgggatagattatatgagtgtcagacttaca
ggggatgaagagcctattgctgttagcatagtggcctctggaggatatgatgatgaaggg
gatgatggggatgtgctaatttatactggccagggtggagtccagagaagggatggccaa
atgtttgatcagaaacttgagaggggtaatcttgctttggaaaagagtatgcatcgcggc
aatgaggtgagagtaattaggggtgttatagatgttacaaatccgagggggaagatttat
atgtatgatggcctttacaggatccaggaatcatgggcagagaaaagcaaattgggcgac
tgcagcattttcaggtacaaattgcttagagtacctgggcagcctgaagcatttacattg
tggaaatcaattcaacaatggagggatggaacagcgacacgtgttggagttatcctacct
gacctaacatctggcgcagagagtcaacctgtttgtcttgtaaatgatgttgatgatgag
aagggacctgcttatttcacatatatccctagtctgaagtactcaaaaccttatatgaag
cctaatccgtctatgggttgtcaatgtgttggcggatgccaacctggagggtccgcttgc
ccttgcattcagaaaaacggaggctttttgccctttagttcacttggagttcttgtgagt
tacaaaaccttgatacatgagtgtggttctgcctgttcatgccctccgaattgccgaaat
cgaatgtctcaaacaggtcctaaagcgcgtgtggaggtcttcaaaacaaaaaatagaggt
tggggacttaggtcttgggatcccatacgtggaggtggctttatgtgtgaatatgccgga
gaagtcgttgaagagtctagggtaggtgagcttggcaatgacggtgacgatgattatata
tttgatgctacccgcatgtatgagccattggaacctgtgcgtgattataacgacgaatcg
aaaaaagtcccgtatccccttgtaataagtgcaaaaaagggtggcaatgttgctcgtttt
atgaaccatagttgttcacctaacgtattctggcagcttgttgtacgtgaaaataacaat
gagacatactaccacattgccttttttgccattaggcatattcctcccatgcaagaattg
acttttgattatggcatggttccgccagacaaagcagactgtaggaggaagaagtgcttg
tgtgggtcattgaactgcagaggttacttttactag

DBGET integrated database retrieval system