KEGG   Nicotiana tabacum (common tobacco): 107783654Help
Entry
107783654         CDS       T04643                                 

Definition
(RefSeq) nitronate monooxygenase-like
Organism
nta  Nicotiana tabacum (common tobacco)
SSDB OrthologParalogGFIT
Motif
Pfam: NMO FMN_dh IMPDH His_biosynth PEP_hydrolase Dus Glu_synthase
Motif
Other DBs
NCBI-GeneID: 107783654
NCBI-ProteinID: XP_016460144
UniProt: A0A1S3Z712
LinkDB All DBs
Position
Un
AA seq 333 aa AA seqDB search
MGWRGILGFEYGIVQAPLGPDISGPELVAAVANAGALGLLRAPDWEDPDHVRELIRKTRT
LTSKPFGIGVILTFPHKENLKAILEEKVAVLQLYWGECSKELVLEAHKAGVKVVPQIGSY
EEAKKAADAGVDAIIVQGREAGGHVAGQDGLITLLPRVVDLVRGHDIAVIAAGGIVDERG
YVAALALGAQGVSLGTRFLATEESYAHPTYKRKLIEFEQTEYTDLFGRARWPGAPHRVLA
TPFYKEWKALPSHENETNQPVIGRTIIHGREGEVRRFAGTVPNTSTTGDIESMAMYAGQS
IGLIKEILPAGEVIKMIVEGAQRLIDQQFAPVN
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgggttggagagggatattgggatttgagtatgggatagtgcaagcacccttaggacca
gatatatcaggtccggagcttgttgctgctgttgctaatgctggtgctcttggtcttctt
agagcccctgattgggaagatcctgatcatgtgagggaacttataaggaaaacaagaacc
ttgactagcaaaccatttgggataggtgtaattcttacatttcctcacaaggaaaattta
aaggctatattggaggagaaggttgcagtattacagctttattggggtgaatgctcaaaa
gagttggttcttgaagctcataaagctggggtcaaggttgtaccccaaattgggagctat
gaagaagcaaagaaagctgcagatgctggtgtagatgcaattattgtccaaggtcgagaa
gcaggaggccatgttgctggccaggatggtttaattaccttattgcctagagttgtcgat
cttgttcgtggtcatgacattgcagtaattgctgctggaggaattgtggatgagcgtggt
tatgttgctgctctggcccttggtgcacagggtgtgtcactaggaactaggtttctcgca
acagaggaaagctatgcgcacccaacatacaagaggaagctcattgaatttgagcaaaca
gaatacacagacttatttggtcgcgcaaggtggccaggggcaccacaccgcgttctggca
accccgttctacaaggaatggaaggcgctcccaagtcatgagaatgaaacaaatcaacct
gtcattggccgcacaatcatacacggcagggaaggagaggttcgtcgctttgctggtaca
gttccaaatacctcaactactggagatatcgaaagcatggcgatgtatgctggtcagagc
attggtcttataaaggaaattctacctgcaggtgaagtgataaagatgatagttgaaggg
gctcaacgactgattgatcaacaatttgcgcccgtgaattaa

DBGET integrated database retrieval system