KEGG   Nicotiana tabacum (common tobacco): 107784100Help
Entry
107784100         CDS       T04643                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00052  Galactose metabolism
nta00500  Starch and sucrose metabolism
nta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107784100
   00500 Starch and sucrose metabolism
    107784100
Enzymes [BR:nta01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107784100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 107784100
NCBI-ProteinID: XP_016460658
UniProt: A0A1S3Z8D1
LinkDB All DBs
Position
Un
AA seq 918 aa AA seqDB search
MRLHSSSSVEKMKPTLFPSLLRNTFFLVFLLLELSILSPHSVVSIKEQESQQQVGYGYLI
TSVALDSTGNSLFAHLQLINNSSVFGPDIQTLILIASLETNDRLRIRINDANHQRWEVPE
EILHRPRPPSRPSTTHFSSENHSSTTLSNQNSDLEFTLHNTTPFSFTIRRRSTGDTLFDT
SPEHQNPDSTFLIFKDQYIQISSSLPTTRANLYCLGEHTKSTFKLTHNQTLTLWNADIGS
SNVDLNLYGSHPFYMDVRSSANETAAGVSHGVLLLNSNGMDIVCTGDRISYKMIGGLIDL
YFFAGPSPEMAVDQYTQLTGRPAAMPYWSFGFHQCRWGYKNIDDVELVVDSYAKAGIPLE
VMWSDIDYMDGFKDFTLDPVNFPLDRVKIFLRKLHQSGQKYVLILDPGISINNTYDTYRR
GMEEDVFIKRDNMPYQGVVWPGNVYYPDFLNPASGIFWRKEIEKFHDLVPFDGLWLDMNE
LSNFITSPPIPSATNDDPPYKINNSGDHLSINYRTVPATSTHFGNTMEYNVHNLYGLLES
RATYNALVNATGKRPFILARSTFLGSGRYTSHWTGDNAATWNDLAYSIPTILSFGLFGIP
MIGADICGFSGNTTEELCRRWIQLGAFYPFARDHSAHDTTRQELYIWESVAEAAKKVLGL
RYQLLPHFYMLMYEAHTKGTPIARPLFFSFPQDTNTYDISTQFLLGKGVMISPVLKQGAT
SVEAYFPAGNWFDLFNYSRFVSLNQGKFMTLDAPPNHINVHVREGNILAMQGEAMTTQGA
RRTAFKLLVVLSSSGNSTGELFVDDDDEVQMGRDGGRWTIVRFNSNIIGNKIMVKSEVVN
GGYALDQGLVLEKVTLLGLKNVRELKGYELVGCMGSDQQGSTRMMKNIEPSGQFVTMEIS
GISILVGKEFKLVLYISI
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgagattgcactcttcttcctccgtagagaaaatgaaaccaacactgtttccatcttta
ctcagaaacaccttctttttagtcttccttttgctagagttatcaatcctttcaccccat
tctgtagtatccattaaagagcaagaatctcagcaacaagttggctatggttacttaatc
acatctgtggccttagattccactggaaattcactttttgctcatcttcaactcattaac
aactcttctgtttttgggcctgacattcagactcttatcctaattgcaagtttggaaaca
aacgaccgtctccgaatacgaataaatgacgctaaccaccaacggtgggaagtgccggaa
gaaatcctccaccgtccacgaccgccgtctcggccttcaaccacccacttctcgtcagaa
aaccactcctcaaccaccctctcaaaccaaaactcagacctagaattcaccctccacaac
actacccctttcagtttcaccatccgccggcgttccaccggcgatactctctttgacaca
tcgccggagcaccaaaaccccgacagtacattcctcatattcaaagaccagtacattcaa
atctcctcctcattaccaaccaccagagccaacctctactgccttggagagcacacaaaa
agcacgtttaagctcacgcacaaccagactttgactctgtggaatgctgacattggcagt
tccaacgtggaccttaatctctatgggtcccatcctttttacatggacgtccggtcgtcg
gcgaatgaaacggccgccggagttagtcatggggttttgcttctgaatagcaatggcatg
gatattgtgtgtacgggtgataggatcagctataaaatgatcggagggttgattgattta
tatttctttgccggaccttcgccggaaatggcggtggatcagtatacgcagcttactggt
cgtcctgctgctatgccatattggtcttttggttttcaccaatgccggtggggttacaag
aacattgatgatgttgaactggtagtggatagttatgcaaaggctggtatccccctggag
gttatgtggagtgatattgattacatggatggttttaaggacttcacacttgatccagtt
aacttcccattggatcgggtgaaaatttttctcaggaagctccatcagagtggtcagaaa
tacgtacttatattagatccaggtattagtatcaataatacatatgacacctataggaga
ggcatggaagaagatgtcttcataaaacgcgataatatgccctatcaaggggttgtttgg
ccagggaacgtttactatcctgattttctaaatccagctagtggaatattttggagaaaa
gaaattgagaagttccacgatctcgtaccttttgatggtctgtggcttgacatgaatgaa
ctatctaatttcataacttcccctcctataccatcggcaaccaatgatgaccctccctat
aagataaacaactctggtgatcacttgtccatcaattatagaacagttccagccacttcc
acacattttggaaatactatggagtataatgtccataacctttatggattactagaatcc
agagctacttataacgctttggttaatgccactggtaaaagaccattcattcttgcaaga
tcaacttttcttggctctggcagatatacgtcacactggactggagataatgctgctacc
tggaatgatttggcatactccattcctactatcttaagttttggactatttggaattcca
atgattggagcagatatatgtggtttttcagggaatactactgaagagctttgtcgccgc
tggattcagcttggagcattttatccatttgcaagagaccactctgctcatgacactacc
cgccaggagctctatatttgggagtcagttgctgaagcagccaagaaagtccttgggctc
cgatatcagctacttccacacttttacatgctgatgtacgaggcacatacaaaagggact
cccattgcacggccccttttcttctctttccctcaagacaccaacacatatgatatcagc
acacagttccttcttggtaaaggtgtcatgatctcacctgtacttaagcaaggagcaacc
tcagttgaggcatatttccctgctggaaactggtttgacctcttcaattactctcgtttc
gtgagtttgaatcaaggaaaatttatgacacttgatgcaccaccaaatcatataaatgta
cacgttcgtgaagggaacatattggccatgcaaggggaagcaatgacaacacaaggtgct
aggaggactgcattcaagctccttgtcgtgctgagcagcagcggaaacagcactggagaa
ctatttgtggacgacgatgatgaggtgcagatgggaagagatggaggaaggtggacaata
gtcaggtttaacagcaacatcatcggcaataaaattatggttaaatcagaggttgtgaat
ggaggatacgcactggatcaaggattagtccttgaaaaggtaacactattgggattgaaa
aatgtgagagaattgaagggctatgagcttgttggttgcatgggatcagaccagcaaggg
agcacaagaatgatgaaaaatattgaaccgagtggacagtttgttactatggaaatctcg
gggatttcaatattggtcggaaaggagttcaaattagtgctatacattagtatttaa

DBGET integrated database retrieval system