KEGG   Nicotiana tabacum (common tobacco): 107788950Help
Entry
107788950         CDS       T04643                                 

Definition
(RefSeq) alanine aminotransferase 2-like
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00220  Arginine biosynthesis
nta00250  Alanine, aspartate and glutamate metabolism
nta00710  Carbon fixation in photosynthetic organisms
nta01100  Metabolic pathways
nta01200  Carbon metabolism
nta01210  2-Oxocarboxylic acid metabolism
nta01230  Biosynthesis of amino acids
Module
nta_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:nta00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    107788950
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107788950
   00220 Arginine biosynthesis
    107788950
Enzymes [BR:nta01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     107788950
Amino acid related enzymes [BR:nta01007]
 Aminotransferase (transaminase)
  Class I
   107788950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 107788950
NCBI-ProteinID: XP_016466182
UniProt: A0A1S3ZP91
LinkDB All DBs
Position
Un
AA seq 545 aa AA seqDB search
MRRFVADKAKNLITKTRTTYSSPSSSTTTCVLQRRTSSPQSASVLRFLSILHTAPSDSMA
SDYSSTPVTLNNLNPKVLKCEYAVRGEIVNLAQKLHQDLKDNPGSHPFDEILYCNIGNPQ
SLAQQPITFFREVLALCDHPVILDKSETQGLFSADSIERAFQILDQIPGRATGAYSHSQG
VKGLRDTIASGIEARDGFPADPNDIFLTDGASPAVHMMMQLLIGSENDGILCPIPQYPLY
SASIALHGGTLVPYYLDEETGWGLEISELENQLKTAKSKGIKVRALVVINPGNPTGQVLA
EANQRDIVKFCKKEGLVLLADEVYQENVYVPEKQFHSFKKIARSMGFGEKDISLVSFQSV
SKGFYGECGKRGGYMEVTGFSPEIREQIYKVASVNLCSNISGQILASLVMSPPKVGDESY
ESFSAEKEAILSSLARRAKTLEDAFNSLEGVTCNKAEGAMYLFPRINLPAKAIKAAEEAK
TAPDAFYARRLLNATGIVVVPGSGFGQRPGTWHFRCTILPQEEKIPAIVSSLTDFHKQFM
DEFRG
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgcggagattcgtagctgacaaagccaaaaatctcatcactaaaaccaggaccacctat
tcttctcctagtagtagtactactacttgcgtgttacaacgccgcacctcttcccctcaa
tcagcttctgttcttcgtttcttgtccattcttcacacagctccttctgattcaatggct
tccgattattcatctactccggtgactcttaacaaccttaatccaaaggttttgaaatgt
gagtatgctgtccgtggagaaattgtcaaccttgctcagaaattacatcaagacctcaag
gataatccaggctctcatccctttgatgagatattatactgcaatattggaaatcctcaa
tccttggctcagcagcctattactttctttagggaggtccttgcattatgtgaccatcca
gttattttggacaaaagtgaaacacaaggtctgttcagtgcggattcaattgaacgagct
ttccagatcctcgatcaaattcctggcagagctacaggtgcatacagccacagtcagggc
gtcaaaggattacgtgatacaattgcatctggtattgaagctcgcgatggcttccctgct
gatccaaatgatattttcttgactgatggtgcaagcccagcggttcacatgatgatgcag
ttgctcattgggtcagagaatgatggaattctctgtcctatccctcaatatccactttat
tccgcttcaattgccctccatggtggcactcttgttccctattatcttgatgaagaaaca
ggatggggattggagatctcagagcttgagaatcagctgaaaactgcaaaatccaagggt
attaaagttagggctttggttgtgatcaatccaggcaacccaactgggcaggttcttgct
gaggccaaccaacgagatattgtgaaattctgcaagaaagaaggcctcgttcttttggcg
gatgaagtgtatcaggaaaatgtttatgtgcctgagaagcagttccactcgtttaagaaa
attgctcgctctatgggatttggagaaaaggacatctctttagtttcttttcagtctgtg
tcaaaaggattttatggagagtgtggaaagcgaggaggttacatggaggtcactggattt
agccctgagataagggaacagatatacaaagtggcatctgtcaatctgtgttccaacatt
tctggtcagattcttgcaagcctcgtcatgagccccccaaaggtgggtgatgaatcatac
gagtcttttagtgctgagaaagaagctatactctcatccttggcaaggcgtgcaaagaca
ctagaagatgcattcaacagtttggagggtgtaacatgcaataaagcagagggcgcaatg
tatctatttccacgtattaacttaccagctaaagcaataaaagcagcagaagaagctaaa
actgcaccagatgccttttatgctcgacgcctcctcaatgccactggaattgttgttgtc
cctgggtctggatttggccagcgtcctggaacatggcattttaggtgcacaatattaccg
caagaagagaagataccagctattgtatctagtcttacagatttccataagcagttcatg
gatgaattccgcggctaa

DBGET integrated database retrieval system