KEGG   Nicotiana tabacum (common tobacco): 107792204Help
Entry
107792204         CDS       T04643                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and protein-tyrosine-phosphatase PTEN2A-like
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00562  Inositol phosphate metabolism
nta01100  Metabolic pathways
nta04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107792204
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    107792204
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nta01009]
    107792204
Enzymes [BR:nta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107792204
    3.1.3.48  protein-tyrosine-phosphatase
     107792204
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     107792204
Protein phosphatases and associated proteins [BR:nta01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    107792204
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 CDKN3
Motif
Other DBs
NCBI-GeneID: 107792204
NCBI-ProteinID: XP_016469883
UniProt: A0A1S3ZZS4
LinkDB All DBs
Position
Un
AA seq 616 aa AA seqDB search
MDSGSADVSDSQPVTASNAARSTAVDSAPGQSTEEVPSKLSTSGISSWAKNLKIPQPFTG
SQDEQSSGNATKSTFARFTGGLGMRLSPKSPAAENSEGTSTSPSSFIGTFTKGLVDSSKN
AVKAVQVKARHVVSQNKRRYQEGGFDLDLTYITENIIAMGFPAGDMSSGIFGYVEGFYRN
HMEEVIKFFETHHKDKYKVYNLCSERLYDASLFEGKVACFPFDDHNCPPIQLIISFCQSA
YSWLKEDIENVVVVHCKAGMARTGLMISSLLLYLKFFPTAEESMDYYNQKRCVDGKGLVL
PSQIRYVKYFERILMYFNGENQPGRRCMLRGFRLHRCPYWIRPSITVSDHNGVLFSTKKH
PRTKDLSPEDFWFSAPKKGVMVFALPGEPGLAELAGDFKIHFHDGQGDFYCWLNTTMIEN
RKVLTTGDLDGFDKRKLPSPGFQVEVVLVDYDAAFPARPQSETTTRESADSSSANPAPGS
NPTSGGEPAARSNTNQHPGNSDKDDVFSDNESEETGMSKTRQTKAASEASAPADAKPLGS
KNNNDSDKLSSLTHKTEQVSLGGTSSIHSEPKRDGSDGATSGVEVSNPVGGVSDFKVVAA
DASVFSFGDEEDYESE
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggactcaggatctgctgatgtatcagattcacaacctgttacggcatcaaatgcagca
aggtctactgcagtggattctgcaccaggccagtcaacagaggaggtgccttcaaagctc
tctacttcaggcatctcctcatgggccaaaaatttaaaaattccacaaccgttcacggga
tcccaagatgaacaatcatctggaaatgctaccaaatcaacctttgctcgtttcactggt
gggcttggaatgcgtctgtcccctaagtctcctgcagctgaaaattctgaaggaacatca
acatcgccatccagttttattggaacattcaccaaaggattagttgactcttcgaagaat
gcagtgaaggctgtgcaggttaaagcgcgacatgttgtatcccagaataagagaagatac
caggaaggaggatttgatttagatttgacctacataacagagaatataattgccatgggc
ttccctgctggtgatatgagctctggcatttttggctatgttgaggggttctacagaaac
cacatggaagaagtcattaaattctttgaaactcatcataaggataaatacaaagtttac
aatctttgttctgaaagattgtatgatgcttctctgtttgagggaaaggttgcttgtttt
ccatttgatgatcacaactgccctcctattcaactcattatatcgttttgtcaaagtgca
tactcttggttgaaggaggatatcgaaaatgttgtggttgtacattgtaaggcaggaatg
gcaagaactggtttgatgatctctagtcttcttctatacttgaaattctttcctacggcg
gaggagtctatggattactacaaccaaaagagatgcgtagatggaaaaggattagttttg
ccgagccagattagatatgtcaagtatttcgaacgcatcttaatgtacttcaatggagaa
aaccagcctggccgcaggtgcatgctcagaggatttcgcctccataggtgcccttattgg
ataaggccttctattacagtatcggatcataatggtgtgctcttctcaacaaaaaaacat
ccaagaaccaaggatctatcgcctgaggatttttggttcagtgcaccaaagaaaggggtt
atggtttttgctcttccaggcgagcctggccttgcagagttagctggggatttcaaaatc
cattttcatgacggtcaaggagacttttattgttggctgaatacaacaatgatagagaac
aggaaagttctgaccacaggcgaccttgatggttttgacaagagaaaattaccatcacct
ggtttccaagtggaagtagtccttgtggactatgatgctgccttccctgctcgaccccaa
tcagaaaccaccaccagagaatcagctgacagttcaagtgctaatcctgcccctggatct
aatcctacctcaggcggtgagcctgctgccagaagtaacacgaaccaacaccctgggaac
agtgacaaggatgacgtgttctcagacaatgaatctgaggaaactggaatgtcaaagact
agacaaactaaagctgcttctgaagctagtgctcctgcagatgcaaaaccccttgggtcc
aaaaacaataatgattcagataaattatcaagcttgacacataagacagagcaagtctcg
ttgggaggtacaagctctatacacagcgagcctaaaagagatggctcagatggagctacc
tctggtgttgaggtttccaatccggttggaggagtgagtgatttcaaggtagttgcagct
gatgcatctgttttctcatttggtgatgaagaggattatgaaagtgaataa

DBGET integrated database retrieval system