KEGG   Nicotiana tabacum (common tobacco): 107795955Help
Entry
107795955         CDS       T04643                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00020  Citrate cycle (TCA cycle)
nta00190  Oxidative phosphorylation
nta01100  Metabolic pathways
nta01110  Biosynthesis of secondary metabolites
nta01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107795955
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    107795955
Enzymes [BR:nta01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     107795955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 107795955
NCBI-ProteinID: XP_016474151
UniProt: A0A1S4AC19
LinkDB All DBs
Position
Un
AA seq 629 aa AA seqDB search
MWRCVSRGLRASSNRSISGGGHFRRLFSSQTNVGGSSYTVVDHTYDAVVVGAGGAGLRAA
IGLSEHGFNTACLTKLFPTRSHTVAAQGGINAALGNMSEDNWRWHMYDTVKGSDWLGDQD
AIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTG
HALLHTLYGQAMKHNTQFFVEYFALDLLMNSDGSCQGVIALNMEDGTLHRFRATSTILAT
GGYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEGSRGEGG
ILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLPPEVL
KERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDNPDSVVPGL
MAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQRPGENQKPLEKDAGERTIAW
LDKIRNSNGSLPTSKIRLNMQRVMQNNAAVFRTQDTLEEGCQLIDKTWESFHDVQLKDRS
LIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWEN
EKVRLEYRPVHMNTLDDEVESFPPKARVY
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgtgtgtcgcgtggccttcgcgcttcctccaacagatctatctccggcggc
ggccattttcgccgacttttctcctcacagactaatgtgggaggctcgtcatatacggtg
gtggatcacacatacgatgcagtggtggtaggtgcaggcggtgcagggcttcgagcggca
atagggttgtctgagcatggattcaatactgcttgcttaaccaagctctttcctactcga
tctcacaccgttgcagctcagggcggtataaatgcagcattaggcaatatgtcagaggac
aattggaggtggcacatgtatgatacagttaaaggaagtgattggttaggtgatcaggat
gctatccaatatatgtgtagagaagcgccaaaagcagttatagagcttgagaattatggt
ttgcctttctctcgaactgaagatggtaaaatatatcaacgtgcatttggtggtcaaagc
ctagactttggaaaagggggacaagcatatcgttgtgcttgtgctgctgatcggactggg
catgctctactgcatactctttatgggcaggccatgaagcataatacacagtttttcgtg
gaatattttgctttggatttactaatgaacagtgatgggagctgccaaggtgtaatagca
ctaaatatggaggatggtaccttgcatcggttccgtgccacctctactattttggccaca
gggggttatggtcgggcttacttctctgcaacatctgctcatacttgcaccggagatggt
aatgctatggtcgcgcgtgctgggcttcctcttgaggatcttgagtttgtgcagtttcat
ccaactggtatatatggagctggttgtctcattactgaaggatctcgtggtgaaggtggt
attctgaggaatagtgagggtgagcgatttatggaaaggtatgccccaacagccaaggat
cttgcgtcaagagatgttgtttccagatctatgacaatggaaattcgagaagggcgtggt
gtaggaccattgaaggatcatatctatcttcatctcaatcacttacctccggaggtcctt
aaggagagacttcctggtatctctgaaacagctgccatttttgctggtgttgatgtaact
aaggagccaattcctgttttacctaccgtgcattataatatgggaggaatccccacaaat
taccacggagaggtggtcactattaaaggagataatcctgattccgtggtccctggactg
atggctgctggtgaagcagcatgtgcatcagttcatggtgccaatcgtcttggtgcaaat
tctcttctagacattgttgtttttgggcgggcatgtgctaatagggttgctgaaatccaa
agaccaggggagaaccagaagccacttgagaaggatgcaggagagaggaccattgcatgg
ttggacaagattaggaactcaaatggttcactgcctacctcaaagattcggctgaacatg
caaagagttatgcaaaacaatgctgctgtcttccgcacacaagatacactagaggaaggt
tgccagctcattgacaaaacatgggagagtttccatgatgttcagttgaaggatagaagt
ttaatatggaactcagatcttatagagactattgagctggaaaaccttttgatcaatgca
tgcatcaccatgcactcagctgaggctagaaaggaaagcagaggagctcatgctcgtgaa
gattttacgaaaagagatgatgagaagtggatgaaacatacactaggatattgggagaac
gagaaggtccggctagagtacagaccagttcatatgaacactctagatgacgaggttgag
tcattcccacccaaggcacgtgtctattga

DBGET integrated database retrieval system