KEGG   Nicotiana tabacum (common tobacco): 107797268Help
Entry
107797268         CDS       T04643                                 

Definition
(RefSeq) peroxisomal fatty acid beta-oxidation multifunctional protein AIM1-like
  KO
K10527  enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00071  Fatty acid degradation
nta00592  alpha-Linolenic acid metabolism
nta01100  Metabolic pathways
nta01110  Biosynthesis of secondary metabolites
nta01212  Fatty acid metabolism
Module
nta_M00087  beta-Oxidation
nta_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107797268
   00592 alpha-Linolenic acid metabolism
    107797268
Enzymes [BR:nta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     107797268
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     107797268
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     107797268
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 3HCDH_N Mto2_bdg Cnn_1N DivIC DAO DUF3450 Uso1_p115_C
Motif
Other DBs
NCBI-GeneID: 107797268
NCBI-ProteinID: XP_016475626
UniProt: A0A1S4AG53
LinkDB All DBs
Position
Un
AA seq 487 aa AA seqDB search
MVNKVLLPRTERRSITYRADLPGIMIEHMQKVAEFKDGNHGLPYGFLLTKVFEFFKVPLR
KSKVGTRKQTFSKTTLEECECIDKVGGVGSTSTISQLINAQNSATDEIRKLKARNAILEG
QLNQLQEAPGSSSSQSTKVARQTKENVDLKKQVEDLKEKMLNEQMSTNSSKPLPLPLSLP
LPVLPRECALSRDGKFCGGLDINLVQNVQKNGDISLLPDASVDLVIDIIENGKKPSVAAI
QGFALGGGLELAMGCSARIATPRAELGLPELKLGIIPGCGGTQRLPRLVGTSKAVDMLMS
SKIITSEEGKDLGLINDAVSSEDLLTVSRLWALDIAEGRQTRLNTLQRTDKIEPIRESSA
ILETARQKILKTSPSMPHYKACLDVIEEGIISGGYAGVLKEDKVLRELVLSKSARALLHV
YFAERATSKVPCITDCQLKHQKIEKVAVIGGGLMGSGIATALILSSVQVILKEIDYDCLQ
KSLKSIE
NT seq 1462 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacaaggttttgctccctcgtactgaaagaaggtcaattacatatcgagcagac
ctgcctggcattatgatagaacatatgcaaaaggtggcagagtttaaggatggtaatcat
ggtctgccttatgggttccttctcaccaaggtgtttgagttcttcaaagtccctttgaga
aaatctaaggtgggtactcgtaagcaaaccttctccaagaccactctggaggagtgtgag
tgtattgataaagttggaggggttggcagcacttctactatctcccagttgatcaatgcc
caaaacagcgccactgatgaaatcaggaagctgaaggcaaggaatgccattcttgagggt
cagctaaatcagcttcaggaggcacctggctctagtagctctcaaagcacaaaggttgcc
cgtcagaccaaggagaatgtcgatctcaagaaacaggttgaggacctgaaggagaaaatg
ctcaatgagcagatgtccacaaactcctcaaaacccttgcctcttcctctaagccttccc
cttccagtgctccctagagagtgtgccctttccagggatggtaaattctgtggtggtctt
gacatcaacctagttcagaatgttcaaaagaacggggatatctcacttctaccggatgca
tcagttgatcttgtgattgacataatagaaaatgggaagaagccttctgttgctgctatt
caaggatttgcccttggtggtggcttggagttggccatggggtgcagtgctagaattgca
acgccgagggctgagcttggtctacctgaacttaagcttggaattattcctggttgtgga
ggcactcagcgtcttccaaggcttgttgggacatcaaaggccgttgatatgttgatgtca
tccaagatcattacctctgaagaagggaaggacttgggacttatcaatgatgctgtatct
tccgaagacctcttaacagtttctcgtctctgggcattagatattgcagaaggacggcaa
acccgtcttaatacacttcaaaggacagataaaattgaacctatacgcgagtcatctgct
atcctggaaactgctaggcaaaagattttgaagacatctccaagtatgcctcattataaa
gcctgcctcgatgtgattgaagagggcatcatttctggaggttatgctggagttttgaag
gaggacaaggttttaagagaattagtcctctcaaaatctgctagagctctgcttcatgta
tattttgctgaacgagcaacatcaaaggtaccatgcattactgattgtcagcttaaacac
cagaagatagagaaggttgctgttataggtggtggtttaatgggctctggtattgccaca
gctcttatactcagttctgtacaagtcattctgaaagaaattgattatgactgtctgcaa
aagtcacttaaatcaatagaag

DBGET integrated database retrieval system