KEGG   Nicotiana tabacum (common tobacco): 107798737Help
Entry
107798737         CDS       T04643                                 

Definition
(RefSeq) L-idonate 5-dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00040  Pentose and glucuronate interconversions
nta00051  Fructose and mannose metabolism
nta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    107798737
   00051 Fructose and mannose metabolism
    107798737
Enzymes [BR:nta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     107798737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 DUF43
Motif
Other DBs
NCBI-GeneID: 107798737
NCBI-ProteinID: XP_016477253
UniProt: A0A1S4ALD0
LinkDB All DBs
Position
Un
AA seq 367 aa AA seqDB search
MVIREHISTDDAENSITEEENMAVWLLGIKTLRIQPYSLPPLGPYDVKIQIKAVGICGSD
IHHFKNMRVANFVVKRPMVLGHECAGIVEQVGSQVKSLMIGDRVALEPGISCRQCHLCKD
GRYNLCRQMKFFGSPPTNGALANQVVHPADLCFKLPDSVSLEEGAICEPLSVGVHACRRA
KVGPETKIIIIGAEPIGLVTMLAARAFGSPKIVIVDIDDQCLSFAKDLGADEIIKVSSNV
QDVEDEVGQICNAMGGPVDMSFDCVGFNKTMLMALQTTHPGGKVCLVGLGQSEMTLPLTS
AAAREVDVIGIFRYRNTRPLCIELLRTGKIDVKPLITHRYRFTQDEVEEAFETSSRGGNA
IKVMFRL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggtgatcagggaacatatatcaactgatgatgcagaaaacagtataacagaagaagag
aacatggcagtttggcttcttggtatcaaaacacttcgaattcaaccatatagtctccca
cctcttggtccttatgatgtcaagattcaaattaaagctgtgggtatatgtggaagtgat
atccatcatttcaagaatatgagagtagcaaatttcgtggttaaaaggccgatggtactt
gggcatgaatgtgctggaattgtagagcaagttggtagccaggtgaagtccctgatgatc
ggcgatcgtgtagctttggagcctggtattagttgcaggcagtgtcacttatgcaaagac
ggtcgctacaatctctgccgtcaaatgaaattctttggctctcctccaactaatggtgct
ttagccaatcaggtggtacatcctgcagatctgtgttttaaattaccggatagtgtaagc
ttggaggaaggggcaatatgtgaacctctgagtgttggtgttcatgcttgtcgtcgtgcc
aaggtaggaccagaaaccaaaataatcattataggtgcagaacctatcggccttgtcact
atgctggcagctcgtgcttttggatcaccgaagatagtcattgttgatatagatgaccag
tgtttatctttcgccaaagaccttggtgctgatgagatcattaaagtttcttccaatgta
caggatgtggaagatgaagtgggacaaatatgcaatgcaatgggaggtcctgtggatatg
agctttgattgtgttggttttaacaagactatgttgatggctctgcaaaccacccatcct
ggtggtaaggtttgcctcgttggattaggccaaagcgagatgactctccctcttacttca
gctgctgcaagggaggtggatgtcataggcattttcagatatagaaatacacggccactc
tgcattgaacttctcagaactggtaaaatagatgtgaaacctctcataacccacaggtat
aggtttactcaagatgaagtggaagaagcctttgagaccagttctcgcggtggaaatgcc
atcaaggtcatgttcagactatag

DBGET integrated database retrieval system