KEGG   Nicotiana tabacum (common tobacco): 107800470Help
Entry
107800470         CDS       T04643                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase 4, chloroplastic-like
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00010  Glycolysis / Gluconeogenesis
nta00030  Pentose phosphate pathway
nta00051  Fructose and mannose metabolism
nta00052  Galactose metabolism
nta01100  Metabolic pathways
nta01110  Biosynthesis of secondary metabolites
nta01200  Carbon metabolism
nta01230  Biosynthesis of amino acids
nta03018  RNA degradation
Module
nta_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107800470
   00030 Pentose phosphate pathway
    107800470
   00051 Fructose and mannose metabolism
    107800470
   00052 Galactose metabolism
    107800470
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    107800470
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nta01009]
    107800470
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:nta03019]
    107800470
Enzymes [BR:nta01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     107800470
Protein phosphatases and associated proteins [BR:nta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107800470
Messenger RNA biogenesis [BR:nta03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     107800470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase SEFIR
Motif
Other DBs
NCBI-GeneID: 107800470
NCBI-ProteinID: XP_016479126
UniProt: A0A1S4ARB5
LinkDB All DBs
Position
Un
AA seq 537 aa AA seqDB search
MELSFSNASSLRFLQTDSVPLHYCSIPGSFHTFSNSYLASKSISLRRPLIWRQPRSVRLR
AESVSPTESNGSVDKHVDDDFIIEDVPHLTDFLPHLPSYPNPLKRSQAYAIVKETFVNPE
DVVAKNIIVQKDSPRGVHFRRAGPREKVFFTPEEVRACIVTCGGLCPGINTVIREIVCGL
KNMYGVDDVIGIQGGYRGFYSKNTLNLTTKVVTDIHKRGGTFLQTSRGGHDTKKIVDNIQ
DRGINQVYIIGGDGTQKGAAAIYKEVEKRGIKVAVAGIPKTIDNDIAVIDKSFGFDTAVE
EAQRAINAAHVEAESMENGVGIVKLMGRYSGFIAMLATLGNRDVDCCLIPESPFFLEGPG
GLYEYVEQRLKENGHVLIVLAEGAGQEYVAQSMQAFQEKDASGNRLLLDVGLWLTQHIKD
HFTNIRKMTINMKYIDPTYMIRAIPSNASDNIYCTLLAQSAVHGAMAGFTGFTVGPVNSR
HAYIPIDRVTETTNTVNLTGRMWARLLASTNQPSFIQHSQAERERELIDRLLMQFTI
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggaactctctttctccaacgcttcttcacttcgttttcttcaaactgattctgttcca
ctccattattgctcaatacctggatccttccataccttttcaaactcatatttggcatca
aaatctatttctctacggagaccgttgatttggcggcaacctcgttcagttagactcaga
gctgaaagtgtaagccctaccgagagcaatggcagtgttgataaacatgtcgatgacgat
tttatcatagaggatgttcctcacttaaccgattttctccctcatttaccgtcatatcca
aatccattgaaaaggagccaagcttacgctattgtcaaggaaacttttgttaatccagaa
gatgtggtggcaaaaaatatcattgttcagaaggacagccccagaggagtacattttcgg
cgtgcaggacctcgagaaaaggttttctttacaccagaagaagtccgtgcttgtattgtg
acatgtggtggtttatgcccaggaatcaatacagtgattcgtgaaattgtatgtggctta
aagaatatgtatggagttgatgatgtaattggaattcagggaggttacagagggttctac
tcaaaaaataccctgaacttgacaacaaaagttgtcactgatattcataaacgtggtggc
acctttcttcaaacatctagaggaggtcatgatactaaaaagattgttgacaacattcaa
gaccgtggaataaatcaggtatacataattggaggggatggaactcaaaaaggggctgct
gcaatctacaaggaagttgaaaagcgtggtattaaagtagctgttgctgggattcccaag
acaattgataatgatatcgcagtgatagacaaatcttttggctttgatactgcggttgag
gaagctcagagggccattaatgctgcacatgtagaggcagaaagcatggagaatggagtt
ggtatagtaaagcttatgggaagatacagcggattcattgcaatgcttgcaactttgggt
aaccgtgatgtggactgttgcttgatcccagagtccccattttttttagaaggtccaggc
gggctctatgaatatgtggaacagcggctcaaagagaatgggcatgtgttaattgttttg
gcagaaggtgctgggcaggaatatgttgctcaaagtatgcaagcatttcaagagaaagat
gcatcaggaaacaggctactcttagatgtcggtctttggttaacacaacatattaaggat
catttcacaaatatccggaagatgacaataaatatgaaatacatagaccctacttacatg
attcgagcaattccaagcaacgcatcagataacatctactgtacacttcttgcacaaagt
gctgtccatggagcgatggctggattcacaggcttcactgttggacctgtaaacagcaga
catgcttatattccaattgaccgtgttactgaaactacaaacactgtgaacttgacaggc
aggatgtgggcacgccttcttgcctccactaatcaaccaagtttcattcaacactctcag
gctgagagagagagagagttgatagacagactattgatgcaattcacaatatga

DBGET integrated database retrieval system