KEGG   Nicotiana tabacum (common tobacco): 107801292Help
Entry
107801292         CDS       T04643                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00010  Glycolysis / Gluconeogenesis
nta00053  Ascorbate and aldarate metabolism
nta00071  Fatty acid degradation
nta00280  Valine, leucine and isoleucine degradation
nta00310  Lysine degradation
nta00330  Arginine and proline metabolism
nta00340  Histidine metabolism
nta00380  Tryptophan metabolism
nta00410  beta-Alanine metabolism
nta00561  Glycerolipid metabolism
nta00620  Pyruvate metabolism
nta00903  Limonene and pinene degradation
nta01100  Metabolic pathways
nta01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107801292
   00053 Ascorbate and aldarate metabolism
    107801292
   00620 Pyruvate metabolism
    107801292
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107801292
   00561 Glycerolipid metabolism
    107801292
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    107801292
   00310 Lysine degradation
    107801292
   00330 Arginine and proline metabolism
    107801292
   00340 Histidine metabolism
    107801292
   00380 Tryptophan metabolism
    107801292
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107801292
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    107801292
Enzymes [BR:nta01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     107801292
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh AAA_25
Motif
Other DBs
NCBI-GeneID: 107801292
NCBI-ProteinID: XP_016480085
UniProt: A0A1S4AU40
LinkDB All DBs
Position
Un
AA seq 536 aa AA seqDB search
MAARVFASRLSRSFTSSSHLLSRGSKSYLGRIAAYQYSTAAAIEEPIKPAVNVEHTKLFI
NGQFVDAASGKTFPTLDPRTGEVIAHVAEGDAEDINRAVAAARKAFDDGPWPKMNAYERS
KILLRLADLIEKHNDQIATLETWDTGKPYEQAAKIEVPMVVRLLRYYAGWADKIHGMTIP
ADGPYHVQTLHEPIGVAGQIIPWNFPLLMFSWKIGPALACGNTVVLKTAEQTPLSAFYVA
HLLQEAGLPEGVLNIISGFGPTAGAPLCCHMDVDKLAFTGSTDTGKAILSLAAKSNLKPV
TLELGGKSPFIVCEDADIDTAVEQAHFALFFNQGQCCCAGSRTYVHEKVYDEFLEKAKAR
ALKRTVGDPFKSGTEQGPQIDSKQFHKIMNYIRSGIDSGATLETGGERLGERGYYIKPTV
FSNVKDDMLIAQDEIFGPVQSILKFKDLDDVIRRANNSRYGLAAGVFTQNIDTANTLTRA
LRVGTVWVNCFDTFDATIPFGGYKMSGHGREKGEYSLKNYLQVKAVVTPLKNPAWL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcgtgtgtttgcctcgcgtctctctcgctctttcacatcctcttctcatctg
ctttcgaggggaagtaaatcctatctgggcagaatagctgcttatcaatacagcacggcg
gctgctattgaggaaccgatcaaaccagctgtcaatgtggaacatactaaactttttatc
aatggtcaatttgttgatgctgcatcaggaaaaacattcccgactctcgaccccaggact
ggggaggtaattgcacatgttgctgaaggtgatgcagaagatataaatcgggcagtagct
gctgctcgtaaggcttttgatgacggaccatggcctaaaatgaatgcttatgaaaggtca
aagatattgctacgccttgctgatctgattgaaaaacataatgatcaaattgcaacgctc
gagacttgggatactgggaaaccatatgaacaggctgctaagattgaagtaccaatggtt
gtacgtctactccgttattatgctggctgggcagataaaattcatggtatgactattcct
gccgatggaccatatcatgttcagacgttgcacgaaccaattggggttgctggtcagatt
atcccatggaattttcctcttctcatgttttcttggaagattggacctgctttagcttgt
gggaatactgtcgtgctaaagacagctgagcagacaccattatctgcattctatgtagca
catctgttacaggaggctgggctgcctgaaggtgttttgaatatcatttctggttttggt
cctacagctggtgctcctctttgttgtcatatggacgtggataagcttgcatttactgga
tcaacagatacaggaaaagctatactttcattggctgctaagagtaatcttaagcctgtg
actttggaacttggagggaaatccccatttattgtttgtgaggatgctgatattgatacg
gccgttgaacaagctcactttgctctcttctttaatcaggggcaatgttgctgtgctgga
tctcggacttatgttcacgagaaagtttatgatgaatttctggagaaggcaaaggcacgt
gccttgaaacgcacagttggtgatccgtttaaatcaggcactgagcagggtcctcagatt
gattcaaaacagtttcataagatcatgaattacattagatctggtatcgatagtggagca
acccttgaaactggaggtgagcgacttggtgaacggggatattatattaagcccacagtt
ttctctaacgttaaggacgatatgctgattgcacaagatgaaatttttggtccagtgcag
tccatcttaaaatttaaggatcttgatgatgtgatacggagagctaataacagtcggtat
ggtctagctgctggagtatttacacagaacattgacactgcaaacacattgacacgagcc
ttgagagttgggacggtatgggttaattgctttgatacctttgatgctacaattcctttt
ggtggctataagatgagtggacacggaagagaaaagggagaatacagtctcaagaattac
ttgcaagtaaaggcagttgtgaccccattgaagaatcctgcatggttataa

DBGET integrated database retrieval system