KEGG   Nicotiana tabacum (common tobacco): 107804984Help
Entry
107804984         CDS       T04643                                 

Definition
(RefSeq) glutamate decarboxylase-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00250  Alanine, aspartate and glutamate metabolism
nta00410  beta-Alanine metabolism
nta00430  Taurine and hypotaurine metabolism
nta00650  Butanoate metabolism
nta01100  Metabolic pathways
nta01110  Biosynthesis of secondary metabolites
Module
nta_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107804984
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107804984
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107804984
   00430 Taurine and hypotaurine metabolism
    107804984
Enzymes [BR:nta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107804984
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Met_gamma_lyase
Motif
Other DBs
NCBI-GeneID: 107804984
NCBI-ProteinID: XP_016484442
UniProt: A0A1S4B6G7
LinkDB All DBs
Position
Un
AA seq 496 aa AA seqDB search
MVLSKAASENDVSVHSTFASRYVRVSLPRFQMPENSIPKEAAYQIINDELMLDGNPRLNL
ASFVTTWMEPECDKLIMAAINKNYVDMDEYPVTTELQNRCVNMIAHLFNAPLGEEETAVG
VGTVGSSEAIMLAGLAFKRKWQNKMKAQGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLEDGYYVMDPEKAVEMVDENTICVAAILGSTLNGEFEDVKRLNDLLVEKNKETGWDTP
IHVDAASGGFIAPFLYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKEDLPEEL
IFHINYLGADQPTFTLNFSKGSSQVIAQYYQLIRLGYEGYRNIMENCQENARVLKEGLEK
TGKFNIVSKEIGVPLVAFSLKDNSRHNEFEVSDHLRRFGWIVPAYTMPPNAEHVTVLRVV
IREDFSRTLAERLVADIEKVLHELDSLPARVSAKLAAAEESSSGVHKKSAMEVQLEITNV
WKKFVAEKKKTKNVIC
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggttctatccaaggccgcctcggagaacgatgtctccgttcattccaccttcgcttct
cgctatgtccgagtttctcttccacggtttcagatgccagagaattcaataccaaaggaa
gcagcatatcaaataataaacgatgagttgatgttggatggaaacccaaggctgaatttg
gcgtcgtttgtgacgacgtggatggaaccagagtgtgataagctaatcatggctgccatt
aacaaaaactatgttgacatggatgaatatcctgtcaccactgagcttcagaatcgatgt
gtaaacatgatagcacatttatttaatgcaccattgggagaggaagagactgcagttgga
gttggaacagttggatcctcagaagccataatgcttgctggattagcatttaagagaaaa
tggcaaaacaaaatgaaagcccaaggaaaaccctatgataagcccaatattgttactggg
gccaatgtccaggtatgttgggagaaatttgcaaggtatttcgaagtagagctaaaggaa
gtaaagttagaggatgggtactacgttatggaccctgagaaagctgtagaaatggtggat
gagaacactatttgtgtagctgctatcttgggttccacccttaatggagaatttgaagat
gttaaacgtttgaatgatctcttagtcgagaagaacaaagaaactgggtgggacactcca
attcatgtggatgcagcaagtggtggattcattgccccattcctatatccagaacttgaa
tgggatttcagattaccattagtaaaaagtattaatgtaagtggtcacaaatatggtctt
gtttatgctggtattggttgggttatttggagaagcaaagaagatttgcctgaagagctt
atcttccatattaattatcttggtgctgatcaaccaaccttcacccttaacttttctaaa
ggttctagtcaagtaattgctcaatattatcaacttattcgcttaggctatgagggatat
aggaatattatggagaattgtcaagaaaatgctagggtactcaaagaaggacttgaaaag
acaggaaaattcaacatagtttccaaagaaattggagttccattagttgcattctctctc
aaagacaacagtagacacaacgaattcgaggtttcggaccatcttaggaggttcgggtgg
attgtgccagcatacacaatgccaccaaatgctgagcacgtgaccgtgctcagggttgtg
atccgagaagatttctcccggacactagctgagaggctcgtggcggacattgaaaaagtc
ctccatgagctcgactcgctcccggccagagtctcagctaagttggctgcggccgaggag
agtagcagtggagtgcataagaaatcggcaatggaagtgcaattggagatcactaatgta
tggaagaagtttgttgccgaaaaaaagaagacaaaaaatgtaatatgttaa

DBGET integrated database retrieval system