KEGG   Nicotiana tabacum (common tobacco): 107805422Help
Entry
107805422         CDS       T04643                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta03030  DNA replication
nta03410  Base excision repair
nta03420  Nucleotide excision repair
nta03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:nta00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107805422
   03410 Base excision repair
    107805422
   03420 Nucleotide excision repair
    107805422
   03430 Mismatch repair
    107805422
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nta03032]
    107805422
   03400 DNA repair and recombination proteins [BR:nta03400]
    107805422
Enzymes [BR:nta01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     107805422
    6.5.1.6  DNA ligase (ATP or NAD+)
     107805422
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     107805422
DNA replication proteins [BR:nta03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    107805422
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     107805422
DNA repair and recombination proteins [BR:nta03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     107805422
   NER (nucleotide excision repair)
    Other NER factors
     107805422
   MMR (mismatch excision repair)
    Other MMR factors
     107805422
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C RNA_ligase RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 107805422
NCBI-ProteinID: XP_016484944
UniProt: A0A1S4B7U9
LinkDB All DBs
Position
Un
AA seq 1426 aa AA seqDB search
MSSDAGTLTLDSTTLYTTALSSLPGQSSSHSNPPPLPLPALPPSVPQPKLIPKTRFIIDG
FKYAGDFSVSYFLSHFHSDHYTGLSPNWSKGIIFCSSITANLLIQVLNVPAQFVVSLPLS
EAVLIDGSEVFLIDANHCPGAVQFLFKNPVNYGKFERYIHTGDFRYCDKMKLEPVLNAFV
GADAVFLDTTYCNPKFIFPSQDASIDYIVGVIEKYGAENEGSLKHILFLIATYVIGKERI
LVEVAWRCKRKIHVDGRKIAVLKVLGHGEDGVFTTFESETDVHVVGWNVLGETWPYFRPN
FVKMNEIMREKGYSKVVGFVPTGWTYEVKRNKFSVRKKDSFEIHLVPYSEHSNYDELRQY
VKFLKPKRVIPTVGIDVEKLDSKHANAMRKHFAGLVDEMSIKQEFLMGFHRCVQGEEDMD
AKESPNASISITNQENRGESAHALVSITKQENEDTSLDSKICNNGDREDIIHSFPQGEPE
LQGLEKISEGDVEEELKELKDCLPIWVTKDQMLDLLSISGKNIVDAVTNFYEHETEYRER
VTVSNSPTSSFEPNSPNGFALPFNPKGDESMLSPKPWVGKSPQQGETTASNKTFKLPNMN
RSSCKTIFPGKRKRSAENKSLKKARGNVSMEPGGSKQCTITKFFSKKPPPSVQNGNGATA
SRNSHDDNSVLLSASVESYKEEADRFIQIVNGDESLRSYAATVLAKTKGDISMALDIYFS
EHKDVGCGISESSKVVQPAKEVFPSSKDEKLPKKLGNDPDLSLSGVPLANTAVNYVSLPP
EKYSPLEHASWSKGQAAPYLHLSRTFELVEEEKGKIKVTSMFCNMFRSLLALSPEDVLPA
VYLCTNKIAPDHENTELNIGGSTVIAALEEACGTKRSKVRELYNSLGDLGDVAQLCRQTQ
SLLAPPVALTIRGVYSTLRRISLQAGSGSGVRKKSLIVNLMCSCREKEMKFLVRTLVRNL
RIGAMMRTVLPALAQAIVFNSLLYDGPVENMKENLQRLSAEAVEAYNILPSLDVLVPSLM
EKGIEFSSNTLSMDPGIPIKPMLAKITNGAPQVLKLFQNKAFTCEYKYDGQRAQIHKLAG
GSVRVFSRNGDETTSRFPDLVNIITESCGPRGATFILDAEVVAIDRKNGSKLMSFQELSS
RERGTKDSIIALDKIKVEICIFVFDIMFANGEQLLHVPLRQRRKYLKDLFGDGKVGYFEY
AAEMTVESDDACADNEATLARMNSFLDDALHSSCEGIMVKSLDIDAGYTPSKRTDAWLKV
KRDYVEGLSDSLDLVLIGAWYGNGRKAGWYSPFLMACYNPDTEEFQSVCRVMSGFSDSFY
IEMEEFFSGDKIFNKKPHYYRTAEVADMWFSPEVVWEIRGADFTVSPVHHAAIGSVHPSR
GISVRFPRFIRCLSDRKPEECSTSADIADMFRSQTRRMDVNVEHEL
NT seq 4281 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgatgccggaaccctaacccttgactctaccactctctacacaaccgctctt
agctccctccccggtcaatcttcctcacattcaaacccaccacccctccctcttccggct
ctccctccctcagtcccccaaccgaaactgattccaaaaactcgttttatcatcgacggt
ttcaaatatgccggcgatttctcagtttcgtacttcctctctcatttccactccgatcac
tatactggcctgtcccctaattggtccaaaggtatcattttttgctcctccataaccgct
aaccttctcatccaagtcctcaatgttcccgcgcaatttgtagtgtctttaccgctctcc
gaagccgttttaatcgacggctccgaggtatttctcatcgacgccaatcattgtcctggt
gctgtgcagtttttatttaaaaatccagttaattatggcaaatttgagcggtatattcac
acaggtgattttcgttattgtgacaaaatgaaattagagcctgttttaaatgcatttgtt
ggtgctgatgctgtatttttagatacaacttactgtaatccgaaatttatattccctagt
caagatgcgtcaattgattatatagttggtgttatagagaaatatggagctgagaatgag
ggttcattgaaacatatattgtttcttattgctacttatgttattgggaaggagaggatt
ttagtggaggttgcgtggagatgtaagagaaagatccacgttgatggcaggaaaatagca
gttttgaaggtattaggtcatggggaggatggggtgtttactacctttgaatctgaaact
gatgttcatgttgttgggtggaatgtgttgggtgagacttggccatatttcagacccaat
tttgtgaaaatgaacgagatcatgagagagaaagggtattccaaggtggttggttttgtc
ccaactggctggacttatgaagtgaagcgaaataagttttctgtgaggaagaaagattcc
tttgagatacatcttgttccatatagtgaacattctaattacgatgagcttagacaatat
gtgaagtttctgaaaccaaagcgtgtcataccaacagtaggcatagatgttgagaagctg
gatagcaaacatgccaatgccatgcggaagcattttgctggcttggtcgatgagatgtcc
attaagcaagaatttctaatgggttttcatcgttgtgtccaaggggaggaagatatggat
gcaaaagaatctcctaatgcttcaattagtatcaccaatcaagaaaacagaggcgaatct
gctcatgctttagtcagtatcaccaagcaagaaaatgaggatacttcattggattctaag
atctgcaataatggtgatagggaggatattatccattcatttcctcaaggagaacctgag
ttgcaaggtttagaaaaaataagtgaaggcgatgtggaagaagagctgaaagaacttaaa
gactgtttacccatttgggtcactaaagaccagatgctggatttacttagtatttcgggg
aaaaatattgttgatgcagtcactaacttttatgaacatgaaaccgaataccgcgaacgg
gtcactgtcagtaattctcctacctcttcatttgagccaaattcaccaaatgggtttgca
ttgccttttaacccaaaaggagatgaatctatgctgtctcccaaaccatgggttggtaaa
agcccgcagcagggtgagacaactgcatcaaataaaacctttaaactgcccaacatgaac
cgttccagttgcaaaactatttttccgggtaaaaggaagagaagtgctgaaaacaagtcg
cttaaaaaagcaagaggaaatgtaagtatggaacctggtggatcgaagcagtgtactata
acaaagttcttcagtaaaaagcctcctccatccgtgcagaatggtaatggtgcaactgct
agtagaaattcccacgatgataacagtgtgctactaagtgcctccgttgagtcttataaa
gaggaagctgatcggtttattcagattgtgaatggggatgagtctttaagaagttatgct
gccacagtactagcaaagactaaaggagacataagtatggcacttgacatttatttttca
gaacacaaagatgttggatgcgggatttctgaaagcagcaaagtggtgcaacctgctaaa
gaggttttcccttcttccaaagatgaaaagttgcccaaaaaattaggaaatgacccggat
ttatccttgtctggagttcccttagccaatactgctgtaaattatgtatcacttccacct
gagaaatattctcctttggaacatgctagctggagcaaggggcaggctgctccataccta
catctttcacggacttttgaattggtagaggaagaaaaaggcaagataaaagtaacatca
atgttctgcaatatgtttcggagcttgcttgcattgtctcctgaggatgtgcttcctgca
gtgtacttgtgcacaaacaagatagctcctgaccatgaaaatacggaattgaatattggg
ggcagtactgttatagcagcacttgaggaggcatgcgggacaaagagatcgaaagtacga
gaactatataacagcctaggtgatcttggtgatgttgctcaactttgccgacaaacacaa
tcgttacttgctcctccagtggcacttacaattaggggtgtatactctactcttagaagg
ataagtttacaggcaggtagtgggagtggcgtccgaaagaaaagcctcattgtcaatctc
atgtgttcatgtagggagaaggagatgaagtttcttgtcagaactttggtcaggaatttg
cggattggagccatgatgagaactgttcttcctgcattagctcaagctattgtgttcaat
tctcttctttatgatggaccagtcgaaaacatgaaagagaatctgcagcgactttcagca
gaagcagttgaagcatataacatccttcccagcttggatgtacttgttccttctttgatg
gaaaaggggattgagttttcctcaaatacgttgtcaatggatccaggcatacccatcaaa
ccaatgcttgcaaaaattactaatggcgcccctcaagtgctgaagctcttccagaacaaa
gcctttacatgcgagtacaaatatgatggtcagcgagctcaaattcataaattagctggt
ggttcggtccgtgtattttcacggaatggggatgaaacaacatcgagattccctgatttg
gtaaacataattacagaatcatgtggtcccagaggagcgacattcatattggatgcagag
gttgttgcaattgatagaaaaaatggttcaaagctcatgtcgttccaagaactatcttcg
cgagagagagggaccaaagattccatcatcgcattagataaaattaaggttgagatatgc
atttttgtcttcgatatcatgtttgcaaatggagaacaattgttgcatgtgccactccgt
caaaggcgaaaatacctgaaggatttatttggtgatggcaaagtgggttatttcgagtat
gcggcagaaatgactgtagagtccgatgatgcttgtgcagataacgaagccacattggct
aggatgaacagctttcttgatgatgcgctacattcttcttgtgaaggaatcatggtgaaa
tcccttgatatagatgctggatacacaccatcaaagcgcactgatgcatggttaaaggtc
aagagagactacgtggaaggactaagtgattccttggacttggttctgattggtgcttgg
tatgggaatggaaggaaagcaggatggtatagtcctttccttatggcctgctacaaccct
gacactgaggaattccagagtgtctgccgggtcatgtctgggttttctgattcattctac
atagagatggaggagttcttctctggggacaaaatcttcaacaaaaagccacattactat
cgaactgcagaagtggccgatatgtggttttctcccgaagttgtgtgggagataaggggt
gctgacttcacggtgtccccagtgcatcatgcagccattggttcagtccatccatctcgt
ggtatttctgtcagattccctaggttcattcggtgtttgtcagataggaaacctgaggaa
tgtagcacatctgcagatatagccgacatgttccgctctcagactagaagaatggatgtg
aatgttgaacatgaattgtag

DBGET integrated database retrieval system