KEGG   Nicotiana tabacum (common tobacco): 107806864Help
Entry
107806864         CDS       T04643                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial-like
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00564  Glycerophospholipid metabolism
nta01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107806864
Enzymes [BR:nta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     107806864
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 Pyr_redox GIDA FAD_binding_3 NAD_binding_8 Lycopene_cycl HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 107806864
NCBI-ProteinID: XP_016486623
UniProt: A0A1S4BCS1
LinkDB All DBs
Position
Un
AA seq 628 aa AA seqDB search
MATSIRLRRLGAIAVVAGGAYTIVRNPSFSSNDRGDKSTALDTFRRKIADPFAVVPSRAT
QEAALIGSSLSNPLDILVVGGGATGCGVALDAATRGLRVGLVERDDFSSGTSSRSTKLIH
GGVRYLEKAVFNLDYGQLKLVFHALEERKQVIDNAPHLCHALPCMTPCFDWFEAIYYWAG
LKMYDLVAGRHLLHLSRYYSAQESVELFPTLARNGKDKTLKGTVVYYDGQMNDSRLNVAI
ACSAALAGAAVLNHAEVVSLLKDEGDGRIIGARIRNNLSGKEFDAYAKVVVNAAGPFCDA
VRKLADKDAKPMICPSSGVHVVLPDYYSPDGMGLIVPKTKDGRVVFMLPWLGRTVAGTTD
SNTSITMLPEPHENEIEFILDAISDYLNVKVRRTDVLSAWSGIRPLAIDPKAKSTESISR
DHVVAEEHPGLVTITGGKWTTYRSMAEDAVDAAIKSGKLNPANKCLTYNLQLIGADGWEP
ASFTILAQQYVRMKRSHGGKVVPGVMDTAAAKHLSHAYGVLSERVAAIAQNENLGKRLAH
GYPFLEAEVAYCAREEYCESAVDFVARRCRLAFLDTDAAQRALPRIIEILAAEHKWNRSR
QKQELQKGKQFLETFKSSKNAQFHDGKH
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggccacctccattcgcctccgtcgtctcggcgctatcgccgtcgtagccggtggagca
tacacaattgtacggaatccttcattctcatcaaacgaccgcggcgacaagtccactgca
ctcgacaccttccgccggaaaattgctgatcctttcgccgtagttccgtctcgagccact
caggaagcggctctgatcggctccagcttgtcaaatcctctcgacatccttgttgtcggt
ggcggtgccaccggctgcggtgtcgcacttgatgctgcaacgcgtgggctccgtgttggc
cttgtcgaacgagatgatttttcttctggcacttcttcaaggtccactaagttaattcat
ggaggagttcgctatttggagaaagcagttttcaacttagattacgggcagttaaagcta
gttttccatgccctagaggagcgtaaacaggtcattgacaatgctccgcacctttgtcat
gctttaccatgcatgactccttgttttgattggtttgaagcgatctactactgggccggc
ctgaaaatgtatgatctggtcgcggggcgacacctactgcatttgtctaggtattattct
gcacaagagtctgttgaattgtttcctacccttgcacgaaatggtaaagataaaactctg
aagggaactgtggtatattatgatggacaaatgaacgactcgcgcctcaatgttgcaata
gcatgctctgctgctttggctggtgcagcagtgcttaaccatgcagaggttgtatccctt
ctcaaagatgagggtgatggtagaataattggtgcacgtattcggaacaacttgtcaggt
aaggagtttgatgcatatgcaaaagttgttgttaatgctgctgggcccttttgtgatgct
gtacggaagttggctgataaagatgcaaaacccatgatctgtcccagtagtggtgttcat
gttgtacttcctgattactattctccagacggaatgggcttaattgtcccgaaaactaag
gatggtcgagtggtttttatgcttccatggttgggtagaacagtagctggtactactgat
tcaaacaccagcataacgatgctgccagaacctcatgagaatgagattgaattcattttg
gatgccatctctgattatcttaatgttaaggtacggcgtactgatgtcctatctgcttgg
agtggtatccgccctctagcaattgatcccaaggcaaagagtacagagagcatctccaga
gatcatgttgtcgctgaagagcatcctggtttggtgacaattaccggtggaaaatggact
acatatagaagcatggcagaagatgcggttgatgcggctataaaatctggaaaattgaac
ccagcgaataaatgcttgacatacaacctacaacttataggtgcagatggatgggaacct
gcatcttttacgatacttgctcaacagtatgtccgcatgaaaaggtcacatggaggaaag
gttgttccaggagtgatggacaccgctgctgctaaacatctatctcatgcatatggtgtt
ttgtctgaacgagtggctgctatagctcagaacgaaaatttgggaaaacgactggcacat
ggataccctttcttggaagctgaggttgcctactgtgctcgggaagagtactgtgaatcc
gctgtagattttgtagctagaagatgtcgtcttgccttcctcgacactgatgctgcacag
cgagcactgccacgaataatagagatactggctgcagagcacaaatggaacaggtctagg
cagaaacaagagttgcagaagggaaaacaatttttagaaactttcaagtcatcaaaaaat
gcacaattccatgacgggaagcattag

DBGET integrated database retrieval system