KEGG   Nicotiana tabacum (common tobacco): 107806960Help
Entry
107806960         CDS       T04643                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:nta00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107806960
Enzymes [BR:nta01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     107806960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 107806960
NCBI-ProteinID: XP_016486719
UniProt: A0A1S4BCV5
LinkDB All DBs
Position
Un
AA seq 220 aa AA seqDB search
MAAHTIFTTTTSTTNSLLFSIAAPNTNPSPSLHSSFHGVSLNLKSKTPQSLTLSAATAPK
LLTVFAATKKAVAVLKGNSNVEGVVTLSQDDDGPTTVKVRITGLTPGLHGFHLHEFGDTT
NGCMSTGPHFNPDGKTHGAPEDEIRHAGDLGNIVANADGVAEATIVDNQIPLTGPNSVIG
RALVVHELEDDLGKGGHELSLTTGNAGGRLACGILGLTPI
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggccgcccacacaatattcaccaccaccaccagcactaccaattctttgttattctca
atcgctgcccctaacaccaacccctctccttcacttcactcttctttccacggtgtttcc
ctcaatctcaagtcaaagactccccaatctttgacactttctgctgccactgctcctaaa
cttctcactgtttttgctgctactaagaaagctgttgctgtccttaagggaaattccaat
gttgagggcgttgtcactctctcccaagatgatgatggtccaaccactgtgaaagttcgc
ataactggacttacacctggacttcatggattccatttacacgagttcggtgacactaca
aacgggtgtatgtctacaggaccccatttcaatcctgatggcaagacacatggagctcct
gaagatgaaatccgtcatgcgggtgacctgggaaacatagtggccaatgccgatggtgtg
gctgaagcaacaattgtagataatcagataccattgactggtccaaattcagttattgga
agagcacttgtggttcacgagcttgaggatgaccttggaaagggtggccatgaactcagc
cttaccactgggaatgctggtggacgattggcatgtggcatacttggtttgactccaata
tga

DBGET integrated database retrieval system