KEGG   Nicotiana tabacum (common tobacco): 107810873Help
Entry
107810873         CDS       T04643                                 

Definition
(RefSeq) SWI/SNF complex subunit SWI3C-like
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
nta  Nicotiana tabacum (common tobacco)
Brite
KEGG Orthology (KO) [BR:nta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:nta03021]
    107810873
   03036 Chromosome and associated proteins [BR:nta03036]
    107810873
Transcription machinery [BR:nta03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     107810873
Chromosome and associated proteins [BR:nta03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    107810873
   PBAF complex
    107810873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM-assoc_1 SWIRM Myb_DNA-binding Myb_DNA-bind_6 Pox_Ag35
Motif
Other DBs
NCBI-GeneID: 107810873
NCBI-ProteinID: XP_016491187
UniProt: A0A1S4BQM0
LinkDB All DBs
Position
Un
AA seq 790 aa AA seqDB search
MPASSSETRNRWRRRKREPLISRKAKAQQDDDVFEEEEDEEDIDQQEIEDDDHRNPSNSV
DRSNYSVEMVSEAGDRISEFPLVVRRTVTRPHSSVLNIVATEKAGQCGESRQNGVVLENM
SYGQLQALSAVPADSPALLTEERGEGSGGGSYVISPPQILQGRGVVKHYGSASRIHVVPM
HADWFSPNTVHRLERQVVPHFFSGKSAEHTPEKYMECRNCIVAKYMELPEKHLSVADCHG
VVAGVSADDVTRIARFLDHWGIINYCAVPPKGEALKDVTLYEDSNSDLCVPVAGLKSIDS
LVQFDKPKCCLKARDVYPELVRDFDDDSDFDNSIRELLSELRCNCCSRPVSLSYYQSQKE
IDILLCLDCFHEGGFVTGHSSLDFVKVSSMKDYGDLDGDTWTDQETLLLLEGMQLYNENW
NQIAEHVGTKSKAQCILHFVRLPVDGAPLENIELPGASGPSSSFAGEDHNKSYSNLNGNL
AGPSTENLDSDSKFPFENCGNPVMSLVAFLASAVGPRVAAACAHASLAALSKDDTLTSRN
MTQIDGSTANNGISVGRIHGKDGSPHGDVGNSYQLKDEKPGGQGPWGQHDAGGAPVSTER
VRAAAKVGLAAAAIKAKLFADHEEREIQRLSANIVNHQLKRLELKLKQFAEVETLLMKEC
EQLERTRHRFAAERARMMTVQPGSVRVSRPMGVSGAGAPVVSNIGNSRQQVVSGPLQQSF
ISGYGNNQPMHPNMSFMPQQGMYGFGPRLPLSAIHPSSSTPGMFNAPASSQPALSHSMLR
PVSGTKSGLG
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcttcctcctcagagacgaggaataggtggaggaggcggaagcgggagccttta
atttcaaggaaggccaaggcccaacaagatgatgacgtgtttgaagaagaagaagacgag
gaagatattgaccagcaggaaattgaagatgacgaccatcgaaaccctagcaattcagtg
gatcggagtaattactcagttgaaatggtatcagaagctggggaccgaattagcgagttc
cctttagtagttagacgtactgttactcggcctcattcgtccgtcctgaatattgtagcg
actgagaaggctgggcagtgtggggagagtaggcagaatggggtggtgttggagaatatg
tcgtatgggcagcttcaggcgctttcagctgtgcctgcagatagtccggctttgttgact
gaggaaagaggagaaggcagtgggggtggttcgtatgtgatcagtcctccgcagatattg
cagggtcgtggtgtggttaagcattatggcagtgcaagtcgaattcatgttgtgccaatg
cacgcagattggttttcacctaatacagtgcacagattggaaagacaagtggtgccgcat
tttttctctggaaagtcagctgaacatacaccagaaaaatacatggaatgcagaaattgt
atagttgcaaagtatatggagttgcctgaaaagcacttgtcagttgctgattgccatggg
gttgtagctggtgttagtgctgatgatgtaactcgaattgcaaggtttcttgatcattgg
gggatcatcaactactgtgctgttcctcctaaaggtgaggccctaaaagatgtcacattg
tacgaggactcaaacagtgatctctgtgttccagtggctggtttgaagtctatcgacagc
ttagttcagtttgacaagcctaaatgttgtctcaaggcgagagatgtttatcctgaactt
gtgcgtgattttgatgatgactccgactttgacaactcaatccgtgaactgttgtctgaa
ctacgatgcaattgttgttctcgccctgtttcactgtcgtactatcagtcacagaaagag
attgatattctattgtgtttggattgcttccacgagggtggatttgtcactggtcactct
agcttggatttcgtcaaagtaagctctatgaaagattatggagatctagatggagatact
tggactgaccaggaaacactattgcttctcgagggaatgcaactctacaatgaaaactgg
aatcaaattgcagaacatgttggcaccaagtcaaaggcacagtgcatccttcattttgtc
cgcctgcctgtggatggtgccccattggaaaatattgaacttccaggtgcatctggtccc
tcaagttcttttgcgggtgaagatcataacaaatcttattcaaatttgaacgggaatctt
gcaggaccaagcactgaaaaccttgattctgatagcaaatttccttttgaaaactgtggc
aatccagtaatgtccctggttgcttttttggcatctgccgtgggaccgagagttgctgca
gcatgtgcccatgcttccttggcagcattgtccaaggatgatactttaacatcacggaat
atgactcagatagatggatctacagctaataacgggatcagtgtaggaagaattcatgga
aaggatggaagtcctcatggagatgttggaaattcttatcagctaaaagatgaaaagccg
ggaggacaaggtccatggggtcaacacgatgctggaggtgctccagtgtccactgaaaga
gtaagagctgctgctaaagtcggtcttgcagctgcagctataaaggcaaagctttttgct
gaccatgaagaacgtgagattcaacggttatctgcaaacatagtcaaccatcagttaaag
aggttagagctgaagctgaagcagtttgcagaggtggagaccttgttaatgaaagaatgt
gaacaactggagagaacaaggcaccgctttgctgcagaacgtgctcgaatgatgacagtt
caacctggttcagttcgagtatcccgaccaatgggtgtgtctggtgctggtgcgccggtg
gtcagtaacataggaaatagtaggcaacaagttgtttcaggtcctctacaacaaagtttt
atttctggatatggaaacaaccaaccaatgcatcccaacatgtcatttatgccgcaacaa
gggatgtatggatttggccctcggctgcctctctcagcgatacacccgtcctcttcaaca
cccggtatgtttaatgctccagcaagttcccagcctgctctcagtcattcaatgcttaga
cctgtatctgggacaaaatctggtttgggttga

DBGET integrated database retrieval system