KEGG   Nicotiana tabacum (common tobacco): 107812114
Entry
107812114         CDS       T04643                                 

Definition
(RefSeq) cytokinin hydroxylase-like
  KO
K07425  long-chain fatty acid omega-monooxygenase [EC:1.14.14.80]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00071  Fatty acid degradation
nta00590  Arachidonic acid metabolism
nta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107812114
   00590 Arachidonic acid metabolism
    107812114
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:nta00199]
    107812114
Enzymes [BR:nta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.80  long-chain fatty acid omega-monooxygenase
     107812114
Cytochrome P450 [BR:nta00199]
 Cytochrome P450, animal type
  CYP4 family
   107812114
SSDB
Motif
Pfam: p450 Flu_C_NS2 ASCH
Other DBs
NCBI-GeneID: 107812114
NCBI-ProteinID: XP_016492631
UniProt: A0A1S4BUS9
LinkDB
Position
Un
AA seq 523 aa
MEFVQFSQVLSLISMAAILLFMLGKVIYSCWILPKLRYRKLRTNGFDGPAPIFPLGNIND
MKKELKKTVSPSLSISNHDIHSFAFPYYARWQKLHGNVFIYWLGTEPFLYIADPEFIKKM
SAVVMGKSWGKPRVFKRDRDPLFGNGLVMVEGDKWVNHRHVINPAFSPASLKGMTNLMAE
SATNMLDRWADLIYSGKKEIEIEVEKEITSTAGEIIAKTTFGINYENGGKVFDKLRTLQI
ALFKSIRFVGVPYGNLIYHKEALKAKKLGKEIDALLVSIIEARKKMDKNQYSQHDLLSLL
MLDESANGMDCRLGKTLSTRELVDECKTIFIGGHETSALALTWTMLLLALHPEWQTQLRE
EIKQVFGVGEIDVTRLNALRKMGWVMNEVLRLYSPAPNVQRQAKDDIQVDNNVVIPKGTN
IWIDVVSMHHDKQLWGEDVNEFKPERFKDDVYGGCKHKMGFLPFGFGGRMCIGKNLFLME
YKIVLSLILTRFSFSISPNYKHCPSILLSLRPTHGLPLIIRPL
NT seq 1572 nt   +upstreamnt  +downstreamnt
atggaattcgtccagttttctcaagttcttagcttgataagcatggctgccattcttttg
tttatgctagggaaagtaatatattcttgttggattttgcctaagctgaggtatagaaag
cttaggacaaatggatttgacggaccagctccaattttccctcttggaaatataaatgac
atgaagaaggagttgaagaagacagtttctccttctttgagcattagcaatcatgacatt
cattcatttgcattcccatactatgctcggtggcagaagttgcatggtaacgtatttatc
tactggctaggaacagagccatttctgtacatagcagatcctgaatttataaagaagatg
tcagcggttgtaatgggcaaaagttggggaaagccaagagtatttaagagggatagagac
cccttgtttgggaatggccttgttatggtggaaggggataagtgggttaatcacaggcat
gttattaatcctgctttttcccctgccagcttgaagggtatgacaaacttaatggcggag
tcggccacaaatatgctagaccggtgggcggacctcatatactcagggaagaaagaaatc
gagatcgaagtcgaaaaggaaatcacaagcacagcgggtgaaatcattgcgaaaacaacc
tttggaatcaactacgaaaacggggggaaagtgtttgataaattaagaacactgcaaatc
gctcttttcaagtccatacgttttgttggagtaccatatgggaacctgatatatcataaa
gaggcgttgaaagccaagaaactcgggaaagagattgacgctctccttgtgtcgatcatt
gaagctcgaaaaaagatggacaaaaatcaatattctcaacatgatcttctgagtctgtta
atgctagatgagagtgctaatggcatggattgccgacttggaaagacgttaagtacaagg
gaattggtggatgagtgtaagacgattttcattggaggtcatgagacctctgccttggca
ctcacctggactatgttgcttctggccttgcatcctgaatggcaaactcagctcagagag
gaaatcaaacaagtgtttggagtaggtgaaattgatgttacaaggcttaatgctctcaga
aagatgggatgggtgatgaacgaagtgctaagactatattcaccagcaccaaatgtacag
agacaagctaaagatgatattcaagtggacaataatgtagtcattcctaaaggaacaaat
atatggattgatgtggtgtcaatgcaccacgacaagcagctttggggtgaagacgttaac
gaattcaaaccagaaaggtttaaagatgacgtttatggtggatgcaaacacaaaatggga
ttcttgccttttggttttggaggaagaatgtgcattggcaagaatttgtttctcatggag
tacaagattgtgttgtccttaatcttgactaggttctctttctccatctccccaaactat
aagcattgcccttctatcctgctttctcttaggcccacacatggattgcctcttataatc
cgacccctttaa

DBGET integrated database retrieval system