KEGG   Nicotiana tabacum (common tobacco): 107828011Help
Entry
107828011         CDS       T04643                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta03030  DNA replication
nta03410  Base excision repair
nta03420  Nucleotide excision repair
nta03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:nta00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107828011
   03410 Base excision repair
    107828011
   03420 Nucleotide excision repair
    107828011
   03430 Mismatch repair
    107828011
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nta03032]
    107828011
   03400 DNA repair and recombination proteins [BR:nta03400]
    107828011
Enzymes [BR:nta01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     107828011
    6.5.1.6  DNA ligase (ATP or NAD+)
     107828011
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     107828011
DNA replication proteins [BR:nta03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    107828011
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     107828011
DNA repair and recombination proteins [BR:nta03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     107828011
   NER (nucleotide excision repair)
    Other NER factors
     107828011
   MMR (mismatch excision repair)
    Other MMR factors
     107828011
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 107828011
NCBI-ProteinID: XP_016510748
UniProt: A0A1S4DBM1
LinkDB All DBs
Position
Un
AA seq 775 aa AA seqDB search
MLPLRSCCHHFAQPSLYNRLHFSLKPSSLFLLISPLNPLKTIRPLFLNPNSRTMSTRRSA
FDVLMANSKKKTPTQDSSPKKRKTPEAETSNKTAILENHNQDSILKPNEDTHLVNESKSE
EVLVKKQKMISPDESVTELKKKAANFDPRKAAYWRDGERVPFIFVVKAFDAISKESGRIV
ITEIVTNMLRTVIETTPEDLLPVVYLSANKIAAAHDGLELGIGDASIIKALAEACGTKEA
HIKKQYKELGDLGLVAKASRSSQPLMRKPEALTVAKVFDTFRIIAKESGKDSQEKKKNYI
KSLLVAATDCEPQYLIRLLQTKLRIGLAEQTLLVALAQASVYSDKHSSPPAGVDSPLEEA
AKIVKQVYSVIPVYEKVVPAILADGVWKLSETCSFSPGVPVGPMLAKPTKGVSEILDKFQ
DMEFTCEYKYDGERAQIHYLEDGSVEIYSRNAERNTGKFPDVVAAISRLKKSSATSFVLD
CELVAYDREKQKILPFQILSTRARKNVVMNDIKVNVCIYAFDILYLNGQPLLQEQLNVRR
EHLYKSFEEEPGYFQFATAVTSNDLEEITKFLEAAVNDSNEGLIIKTLSRDATYEPSKRS
NNWLKLKKDYMESIGDSLDLVPIAAFHGRGKRTGVYGAFLLACYDSNNEEFQSICKIGTG
FSEAMLEERSSSLRSKVIPKPKSYYRYAETINPDVWFEPTEVWEVKAADLTISPVHRAAQ
GIVDRDKGISLRFPRLIRVREDKNPEQASSADMVADMFNAQKHNHKNDKDDNEED
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgttgcgctcatgctgtcaccatttcgctcaaccttctctttacaaccgtctc
catttctcccttaaaccctcttcactctttctccttatatccccccttaatccccttaaa
accattagaccccttttcttaaaccctaattcaagaaccatgtcaactcgtcgctctgct
ttcgatgtccttatggcaaattccaagaaaaaaaccccaacccaagattcctcacccaag
aaacgcaaaaccccagaagctgaaacttccaataaaactgctattcttgaaaatcataat
caagattcaattttgaagccaaatgaggacacccatttggttaatgagtcgaaaagtgaa
gaggttctggtgaagaaacagaagatgataagtccagatgagagtgtgactgagctgaag
aaaaaagctgccaactttgatccaagaaaggctgcatattggagggatggtgagagagtg
ccgttcatttttgtagttaaggcgttcgacgcgatttcgaaggagtcaggaagaattgta
attactgaaattgtgactaatatgttgaggactgtgattgagacgacgcccgaggatttg
ttgcctgttgtgtacctttcggctaacaagattgcagctgcacatgatggtttggagctt
ggtattggcgatgcttcgataatcaaggcacttgctgaagcttgtggcactaaagaagca
catattaagaagcaatataaggagcttggagacttgggccttgttgcaaaagcaagccgt
tcatcacagcctctgatgcgtaaaccagaagcattgactgttgccaaagtttttgacacg
tttcgaattattgccaaggaatctgggaaggatagtcaggaaaagaaaaagaattacatt
aaatcactacttgttgcagctactgattgtgaaccccaatatttgattcgtctcctccag
acaaagctacgcattggtttggctgaacaaacactgttagtcgcacttgctcaagcttct
gtgtactcggacaagcattcatcacctcctgcaggtgtagattctcctttggaagaggct
gccaagattgtaaagcaagtgtactctgtaattccggtttatgaaaaagttgttcctgct
attctagctgatggtgtttggaagctttcagaaacatgcagcttctcacctggtgttccg
gttggacctatgctagctaagccaaccaaaggagtatctgaaattcttgataagtttcag
gatatggagttcacatgtgaatacaagtatgacggtgaacgtgctcagatacattacttg
gaagatggttctgttgagatatacagccgaaatgcagaaagaaatactggaaagtttcct
gacgttgttgctgctatctcaagattgaaaaaatcttctgcaacatcatttgttcttgat
tgtgaactggtcgcatatgaccgtgagaaacagaagatcctgccctttcagatcctcagt
acgcgtgctcgtaagaatgttgtcatgaatgatatcaaggtcaacgtttgcatatatgct
tttgatatcttgtatcttaatggacaacctcttcttcaagagcagcttaacgtgcgcaga
gagcatctttacaagtcatttgaagaagaacccggatatttccaatttgctacagctgta
acctcaaacgatcttgaggaaataacaaaatttcttgaagctgcagtgaatgacagtaat
gagggattgattatcaagacgctaagtagagatgctacatatgagccttcaaagcggtca
aataactggctaaaactgaagaaggactacatggaaagtattggtgactcactggatttg
gtaccaattgctgcttttcatggtcgggggaaacgtactggtgtttacggagcctttctc
ctagcttgttatgatagcaacaacgaggagttccagagcatctgtaaaattggaactgga
ttttccgaagcaatgcttgaagaacgctcttccagccttcgttccaaagttattccaaaa
ccaaagtcatattacaggtatgcggaaaccatcaatccagatgtatggtttgaacctact
gaggtatgggaagtgaaagcagctgatcttaccatcagcccagtccaccgtgctgcgcaa
ggtatcgtggatcgcgataagggaatttctttaagatttccacgtttgattcgtgtacga
gaagacaagaatcctgagcaggcctcatcagcagacatggttgcggatatgtttaatgca
cagaagcacaatcataaaaatgataaggatgataatgaagaagactaa

DBGET integrated database retrieval system