Nicotiana tabacum (common tobacco): 107828643 Help Entry 107828643         CDS       T04643                                  Name (RefSeq) uncharacterized LOC107828643   KO K03873   elongin-B Organism nta  Nicotiana tabacum (common tobacco) Pathway nta04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:nta00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     107828643  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:nta04121]     107828643    03400 DNA repair and recombination proteins [BR:nta03400]     107828643 Ubiquitin system [BR:nta04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      107828643    Cul5 complex      107828643 DNA repair and recombination proteins [BR:nta03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      107828643 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Dsc3_N Ubiquitin_2 Motif Other DBs NCBI-GeneID:  107828643 NCBI-ProteinID:  XP_016511481 UniProt:  A0A1S4DDJ5 LinkDB All DBs Position Un AA seq 105 aa AA seqDB search MQAMYIRVKRNRTTYFIQCDPTETILQIKEKLYNLIDQPVNDQRLILMPAGDVLEDSKSL ADQKVENDAVVALTLRKDDNAFEDVNIVRPNDFYQSHDSEGGANW NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgcaggcaatgtatatccgtgtcaagcgtaataggaccacctactttattcaatgtgac ccaaccgagacaattctacaaataaaggagaaattgtataacctcatagatcaaccagtt aatgatcagcgattaatcttgatgcctgctggagacgtgttggaagactcgaagtcccta gctgatcagaaggttgaaaatgatgctgtggtggcactgactctgagaaaagatgacaat gcatttgaggatgtaaatattgtgagaccgaatgacttttaccagtcccacgattcagaa ggtggtgctaattggtga

DBGET integrated database retrieval system