KEGG   Nicotiana tabacum (common tobacco): 107830003Help
Entry
107830003         CDS       T04643                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00620  Pyruvate metabolism
nta00710  Carbon fixation in photosynthetic organisms
nta01100  Metabolic pathways
nta01200  Carbon metabolism
Module
nta_M00168  CAM (Crassulacean acid metabolism), dark
nta_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
nta_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
nta_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    107830003
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    107830003
Enzymes [BR:nta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     107830003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 107830003
NCBI-ProteinID: XP_016512961
UniProt: A0A1S4DHV3
LinkDB All DBs
Position
Un
AA seq 966 aa AA seqDB search
MANRNLEKLASIDAQLRQLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQEC
YELSAEYEGKHDPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRQK
LKKTGDFVDESNATTESDIEETFKKLVGDLKKSPQEVFDALKNQTVDLVLTAHPTQSVRR
SLLQKHGRIRNCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG
MSYFHETIWKGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAANLYYSQIEDLMFELSMWRCNDELRVRSDEVLHSSSRRDAKHYIEFWKQ
VPPNEPYRVILGDVRDKLYQTRERARQLLAHGYSEIPEEATYTNIEQFLEPLELCYRSLC
ACGDRSIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITQHLEIGSYREWSEE
RKQEWLLSELSGKRPLFGPDLPKTEEIADVLDTFHVIAELPADCFGAYIISMATAPSDVL
AVELLQRECRVKQPLRVVPLFEKLADLDAAPAAVARLFSVEWYRNRINGKQEVMIGYSDS
GKDAGRLSAAWQLYKAQEELVKVAKEYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTI
HGNLRVTVQGEVIEQCFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEIAVVA
TEKYRSIVFKEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQT
RFHLPVWLGFGAAFKYAINKDIKNLRMLQEMYNAWPFFRVTIDLVEMVFAKGNPSIAALY
DKLLVSEDLWSFGEQLRSNYEETKSLLLQIAGHKDLLEGDPYLRQRLRLRDSYITTLNVC
QAYTLKRIRDPNYSVTPRPHISKEYMESKPAAELVKLNPTSEYAPGLEDTLILTMKGIAA
GMQNTG
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatcgtaatttggagaaattggcatcaattgatgcacagttgaggcaattggta
cctggtaaagtttctgaagatgataagcttattgagtatgatgctttgcttttggatcgg
tttcttgatattcttcaggatttgcatggtgaagatctcaaagaaacagtccaagagtgc
tatgagctttctgccgagtatgaaggaaagcatgatccgaagaaactggaggagcttggc
aatgtattaacaagtttggatccaggggattcaattgtcattgctaaagctttctctcac
atgcttaacttggccaatttggccgaggaggttcagatcgcctaccgccggcgccaaaag
ctgaagaaaacgggggattttgtcgatgagagcaatgcaacaactgaatcagatattgaa
gaaacttttaagaaactggtgggggacttgaagaagtcccctcaagaagtttttgatgct
ctgaaaaatcagactgtggatctcgtcctaactgctcatcctactcaatctgtccgaaga
tctttgcttcaaaagcatggaaggatccgcaactgcttggctcagttgtatgccaaagac
ataacacctgatgataagcaggagcttgatgaggctttacagagggagattcaagctgct
ttccgcactgatgagatccgaagaactcctccaactccacaagatgaaatgagagctgga
atgagctatttccatgaaacaatttggaagggcgtaccaaagttcctgcgccgtgttgat
acagctctcaaaaacatagggattgatgaacgagttccttataatgcacctcttattcaa
ttctcctcttggatgggtggtgatcgtgatggtaatccaagagtgacgcctgaggtcaca
agagatgtttgcttgttggccagaatgatggcagccaatttgtactattcacaaatagag
gacctcatgtttgagttatctatgtggcgttgcaacgatgagcttcgcgtgcgatcagat
gaagtactccacagttcttcaaggagagatgcaaaacactacatagaattttggaagcaa
gttcctccaaatgaaccttatcgggtaattcttggtgatgtgagagataagctgtatcag
acacgcgagcgtgctcgccaactgttagcccatggatactctgaaattccagaggaagca
acttatactaatattgagcagttcttggaacctcttgagctctgctacagatctctttgt
gcttgtggtgatcggtccatcgctgacggtagccttctggatttcctaagacaagtttcg
acctttggactttcacttgtgagacttgacataagacaagagtcagaccgccataccgat
gtgcttgatgctattactcagcacttagaaattggttcatatcgagaatggtctgaagaa
cgtaaacaagagtggcttctgtctgaactcagcggcaagagacctttatttggacctgat
cttccaaaaactgaagaaattgccgacgttttggacacattccatgtcatagccgaactc
ccagctgactgcttcggggcatacatcatctcaatggccactgcaccatctgatgtgctc
gcagttgagcttctacagcgtgaatgccgagtgaagcaacctttacgagttgttccactt
tttgagaagttggctgatctggatgctgctcctgctgctgttgcacgtcttttctcagtt
gagtggtacagaaaccggataaatggcaagcaagaggtcatgatcggatactctgattct
ggcaaggatgcaggtcggttatcagcagcgtggcagctgtataaggctcaagaggagctt
gtaaaagttgccaaggagtacggcgtgaagctaactatgttccacggcagaggtggtact
gttggacgaggaggtggccccacccatcttgctatattgtctcaaccacccgatacaatc
catggaaatctgcgtgttacagttcagggtgaggtcattgagcaatgttttggggaggaa
cacttgtgttttaggacacttcagcgttttactgctgctacccttgaacatgggatgcat
ccaccagtttctccaaaaccagaatggcgtgcacttatggacgaaattgcagttgttgct
acagagaagtatcgatcaatagtttttaaagaaccccgattcgttgagtatttccgcctg
gccacacccgagttagagtatggtcgaatgaacattggcagccgtccatcaaagcgtaaa
cccagcggaggcatagaatcacttagagctattccatggatctttgcctggactcagact
agattccatctgcccgtgtggctcggctttggagcagcatttaagtatgccatcaacaag
gatatcaaaaacctccgcatgctgcaggaaatgtacaatgcatggccattctttagggta
acaattgatttggttgaaatggtgtttgccaaaggaaaccccagcattgctgcattatac
gacaagcttctggtttcagaagatttgtggtccttcggtgaacaactgaggtcaaactac
gaagagacaaagagcctcctgctgcagattgctggacacaaggatcttttggagggtgac
ccctacttgagacaacgactcaggttgcgtgactcctatatcacaactttgaacgtgtgc
caagcctacaccctaaagcgtattcgtgacccaaactacagtgtcacaccaaggccacac
atatccaaggaatacatggaatcaaagccagctgctgaacttgtgaagctgaacccgact
agcgaatacgcccctggcttggaggacacactcatcttgaccatgaagggtattgctgct
ggaatgcagaatactggttaa

DBGET integrated database retrieval system