KEGG   Nicotiana tabacum (common tobacco): 107832102Help
Entry
107832102         CDS       T04643                                 

Definition
(RefSeq) anthranilate synthase beta subunit 1, chloroplastic-like
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nta01100  Metabolic pathways
nta01110  Biosynthesis of secondary metabolites
nta01230  Biosynthesis of amino acids
Module
nta_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    107832102
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    107832102
Enzymes [BR:nta01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     107832102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-GeneID: 107832102
NCBI-ProteinID: XP_016515400
UniProt: A0A1S4DPQ5
LinkDB All DBs
Position
Un
AA seq 92 aa AA seqDB search
MLTSRYYLSHFSPFTAGRYHSLVIDKDTFPKDDLEITAWTEDGLIMAARHKVYRHLQGVQ
FHPESIITTEGKTIVRNFVKLIEQKEKAETQD
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgctgacatctcgatattacctatctcattttagccccttcacagctggtagataccac
agccttgtaatagataaggacactttccccaaagacgatcttgagataactgcgtggaca
gaagacggtcttataatggctgctcgtcacaaagtttatcgacatctacagggggtgcaa
ttccatcctgaaagcatcatcacaaccgaaggcaagacaatagttcgcaattttgtcaaa
ttgatagagcagaaggaaaaagcagaaactcaagactag

DBGET integrated database retrieval system